Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Chemical Structure

Amylin Biochemical

Amylin (rat)

Purity
>98%
Synonyms
Amylin; Amylin (rat); IAPP; amide; rat; Amylin biochemical
Ordering
For Research Use Only!
Purity/Purification
>98%
Solubility
DMSO
Formula
C167H272N52O53S2
SMILES
[H]N[C@@H] (CCCCN)C (=O)N[C@H]1CSSC[C@H] (NC (=O)[C@@H] (NC (=O)[C@H] (C)NC (=O)[C@@H] (NC (=O)[C@H] (CC (N)=O)NC1=O)[C@@H] (C)O)[C@@H] (C)O)C (=O)N[C@@H] (C)C (=O)N[C@@H] ([C@@H] (C)O)C (=O)N[C@@H] (CCC (N)=O)C (=O)N[C@@H] (CCCNC (N)=N)C (=O)N[C@@H] (CC (C)C)C (=O)N[C@@H] (C)C (=O)N[C@@H] (CC (N)=O)C (=O)N[C@@H] (CC1=CC=CC=C1)C (=O)N[C@@H] (CC (C)C)C (=O)N[C@@H] (C (C)C)C (=O)N[C@@H] (CCCNC (N)=N)C (=O)N[C@@H] (CO)C (=O)N[C@@H] (CO)C (=O)N[C@@H] (CC (N)=O)C (=O)N[C@@H] (CC (N)=O)C (=O)N[C@@H] (CC (C)C)C (=O)NCC (=O)N1CCC[C@H]1C (=O)N[C@@H] (C (C)C)C (=O)N[C@@H] (CC (C)C)C (=O)N1CCC[C@H]1C (=O)N1CCC[C@H]1C (=O)N[C@@H] ([C@@H] (C)O)C (=O)N[C@@H] (CC (N)=O)C (=O)N[C@@H] (C (C)C)C (=O)NCC (=O)N[C@@H] (CO)C (=O)N[C@@H] (CC (N)=O)C (=O)N[C@@H] ([C@@H] (C)O)C (=O)N[C@@H] (CC1=CC=C (O)C=C1)C (N)=O
CAS Number
124447-81-0
Preparation and Storage
Store at -20 degree C for 3 years (powder form); at -20 degree C for 6 months (Solution base)

Chemical Structure

Chemical Structure
Related Product Information for Amylin biochemical
Amylin (rat) is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor. Sequence: Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7);KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7).
Product Categories/Family for Amylin biochemical

Similar Products

Product Notes

The Amylin (Catalog #AAA3841869) is a Biochemical and is intended for research purposes only. The product is available for immediate purchase. It is sometimes possible for the material contained within the vial of "Amylin, Biochemical" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.