Western Blot (WB)
(Host: RabbitTarget Name: MLKLSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse MLKL Polyclonal Antibody | anti-MLKL antibody
MLKL Antibody-middle region
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MLKL; Polyclonal Antibody; MLKL Antibody-middle region; mixed lineage kinase domain-like protein; 9130019I15Rik; anti-MLKL antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
SPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSL
Applicable Applications for anti-MLKL antibody
Western Blot (WB)
Protein Size
472 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse MLKL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: MLKLSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MLKLSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MLKL antibody
Description of Target: This gene belongs to the protein kinase superfamily. The encoded protein contains a protein kinase-like domain; however, is thought to lack protein kinase activity. This protein plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (Rip3), which is a key signaling molecule in necroptosis pathway. Knockout of this gene in mice showed that it is essential for necroptosis. Alternatively spliced transcript variants have been found for this gene.
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
51kDa
UniProt Protein Name
Mixed lineage kinase domain-like protein
Protein Family
UniProt Gene Name
Mlkl
UniProt Entry Name
MLKL_MOUSE
Similar Products
Product Notes
The MLKL mlkl (Catalog #AAA3249752) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MLKL Antibody-middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MLKL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MLKL mlkl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SPNILRIFGI CIDQTVKPPE FSIVMEYCEL GTLRELLDRE KDLTMSVRSL. It is sometimes possible for the material contained within the vial of "MLKL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
