Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SLC26A4 blocking peptide

SLC26A4 Peptide-middlel region

Reactivity
Mouse
Synonyms
SLC26A4; SLC26A4 Peptide-middlel region; Pds; pendrin; SLC26A4 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
NVFSGFFSCFVATTALSRTAVQESTGGKTQVAGLISAVIVMVAIVALGRL
Quality Control
The peptide is characterized by mass spectroscopy
Protein Size
780 amino acids
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SLC26A4 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SLC26A4 Antibody. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Description of Target: Sodium-independent transporter of chloride and iodide.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
85kDa
UniProt Protein Name
Pendrin
Protein Family
UniProt Gene Name
Slc26a4
UniProt Synonym Gene Names
Pds
UniProt Entry Name
S26A4_MOUSE

Uniprot Description

SLC26A4: Sodium-independent transporter of chloride and iodide. Defects in SLC26A4 are a cause of Pendred syndrome (PDS). PDS is an autosomal recessive disorder characterized by congenital sensorineural hearing loss combined with thyroid goiter. The disorder may account for up to 10% of the cases of hereditary deafness. The deafness is most often associated with a Mondini cochlear defect. Defects in SLC26A4 are the cause of deafness autosomal recessive type 4 (DFNB4); also known as vestibular aqueduct syndrome (EVA). DFNB4 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. DFNB4 is associated with an enlarged vestibular aqueduct. Belongs to the SLC26A/SulP transporter (TC 2.A.53) family.

Protein type: Transporter; Membrane protein, integral; Membrane protein, multi-pass; Transporter, SLC family

Cellular Component: apical plasma membrane; brush border membrane; integral to membrane; integral to plasma membrane; membrane; plasma membrane

Molecular Function: anion transmembrane transporter activity; anion:anion antiporter activity; bicarbonate transmembrane transporter activity; chloride channel activity; chloride transmembrane transporter activity; iodide transmembrane transporter activity; oxalate transmembrane transporter activity; secondary active sulfate transmembrane transporter activity; sulfate transmembrane transporter activity

Biological Process: bicarbonate transport; chloride transport; inorganic anion transport; iodide transport; organ morphogenesis; regulation of intracellular pH; regulation of membrane potential; regulation of pH; regulation of protein localization; sulfate transport; transmembrane transport; transport

Similar Products

Product Notes

The SLC26A4 slc26a4 (Catalog #AAA3249388) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SLC26A4 Peptide-middlel region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: NVFSGFFSCF VATTALSRTA VQESTGGKTQ VAGLISAVIV MVAIVALGRL. It is sometimes possible for the material contained within the vial of "SLC26A4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.