Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NTRK1 blocking peptide

NTRK1 Peptide - middle region

Gene Names
NTRK1; MTC; TRK; TRK1; TRKA; Trk-A; p140-TrkA
Reactivity
Human
Synonyms
NTRK1; NTRK1 Peptide - middle region; NTRK1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGED
Sequence Length
760
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NTRK1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- NTRK1 Antibody, made

Target Description: This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, cognitive disability and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date.
Product Categories/Family for NTRK1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84 kDa
NCBI Official Full Name
high affinity nerve growth factor receptor isoform 3
NCBI Official Synonym Full Names
neurotrophic receptor tyrosine kinase 1
NCBI Official Symbol
NTRK1
NCBI Official Synonym Symbols
MTC; TRK; TRK1; TRKA; Trk-A; p140-TrkA
NCBI Protein Information
high affinity nerve growth factor receptor
UniProt Protein Name
High affinity nerve growth factor receptor
UniProt Gene Name
NTRK1
UniProt Synonym Gene Names
MTC; TRK; TRKA; Trk-A
UniProt Entry Name
NTRK1_HUMAN

NCBI Description

This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, cognitive disability and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date. [provided by RefSeq, Jul 2008]

Uniprot Description

TrkA: a receptor tyrosine kinase of the Trk family. High affinity receptor for nerve growth factor, neurotrophin-3 and neurotrophin-4/5 but not brain- derived neurotrophic factor. Known substrates include Shc, PI-3K, and PLC-gamma-1. Has a crucial role in the development and function of the nociceptive reception system. Two splice variant isoforms have been described.

Protein type: Protein kinase, TK; Oncoprotein; EC 2.7.10.1; Membrane protein, integral; Protein kinase, tyrosine (receptor); Kinase, protein; TK group; Trk family

Chromosomal Location of Human Ortholog: 1q21-q22

Cellular Component: protein complex; cell surface; integral to plasma membrane; late endosome membrane; dendrite; early endosome; cell soma; early endosome membrane; axon; late endosome; plasma membrane; cytoplasmic vesicle; receptor complex; endosome

Molecular Function: neurotrophin p75 receptor binding; neurotrophin binding; protein binding; nerve growth factor receptor activity; protein homodimerization activity; ephrin receptor binding; nerve growth factor binding; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: circadian rhythm; axon guidance; mechanoreceptor differentiation; peptidyl-tyrosine phosphorylation; activation of MAPKK activity; nerve growth factor receptor signaling pathway; protein amino acid autophosphorylation; positive regulation of synaptic transmission, glutamatergic; protein amino acid phosphorylation; olfactory nerve development; activation of NF-kappaB transcription factor; negative regulation of cell proliferation; sympathetic nervous system development; response to radiation; learning and/or memory; small GTPase mediated signal transduction; response to axon injury; negative regulation of neuron apoptosis; response to electrical stimulus; detection of temperature stimulus involved in sensory perception of pain; response to hydrostatic pressure; aging; response to drug; response to nutrient levels; phosphoinositide-mediated signaling; adenylate cyclase activation; Sertoli cell development; detection of mechanical stimulus involved in sensory perception of pain; positive regulation of programmed cell death; positive regulation of angiogenesis; response to ethanol; phospholipase C activation; B cell differentiation; Ras protein signal transduction; response to activity; positive regulation of Ras protein signal transduction; transmembrane receptor protein tyrosine kinase signaling pathway

Disease: Thyroid Carcinoma, Familial Medullary; Insensitivity To Pain, Congenital, With Anhidrosis

Research Articles on NTRK1

Similar Products

Product Notes

The NTRK1 ntrk1 (Catalog #AAA3248564) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NTRK1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQHQHIVRFF GVCTEGRPLL MVFEYMRHGD LNRFLRSHGP DAKLLAGGED. It is sometimes possible for the material contained within the vial of "NTRK1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.