LINS1 blocking peptide
LINS1 Peptide - middle region
Gene Names
LINS1; LINS; MRT27; WINS1
Reactivity
Human
Synonyms
LINS1; LINS1 Peptide - middle region; LINS1 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: TAIIKEIFKDSCSQKTEILKQFLTHFDTIFEVFYNSLFSQHFENCRDTSK
Sequence Length
436
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for LINS1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- LINS1 Antibody, made
Target Description: The Drosophila segment polarity gene lin encodes a protein, lines, which plays important roles in development of the epidermis and hindgut. This gene encodes a protein containing a lines-like domain. This gene is located on chromosome 15 and clustered with the gene encoding ankyrin repeat and SOCS box-containing protein 7.
Target Description: The Drosophila segment polarity gene lin encodes a protein, lines, which plays important roles in development of the epidermis and hindgut. This gene encodes a protein containing a lines-like domain. This gene is located on chromosome 15 and clustered with the gene encoding ankyrin repeat and SOCS box-containing protein 7.
Product Categories/Family for LINS1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47 kDa
NCBI Official Full Name
protein Lines homolog 1 isoform 1
NCBI Official Synonym Full Names
lines homolog 1
NCBI Official Symbol
LINS1
NCBI Official Synonym Symbols
LINS; MRT27; WINS1
NCBI Protein Information
protein Lines homolog 1
UniProt Protein Name
Protein Lines homolog
Protein Family
UniProt Gene Name
LINS
UniProt Synonym Gene Names
LINS1; WINS1
UniProt Entry Name
LINES_HUMAN
NCBI Description
The Drosophila segment polarity gene lin encodes a protein, lines, which plays important roles in development of the epidermis and hindgut. This gene encodes a protein containing a lines-like domain. This gene is located on chromosome 15 and clustered with the gene encoding ankyrin repeat and SOCS box-containing protein 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2017]
Uniprot Description
Tissue specificity: Expressed in adult testis, prostate, prostate, spleen, thymus, skeletal muscle, fetal kidney and brain. Ref.1
Sequence similarities: Belongs to the protein lines family.
Research Articles on LINS1
Similar Products
Product Notes
The LINS1 lins (Catalog #AAA3248478) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The LINS1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAIIKEIFKD SCSQKTEILK QFLTHFDTIF EVFYNSLFSQ HFENCRDTSK. It is sometimes possible for the material contained within the vial of "LINS1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
