Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

GTPBP3 blocking peptide

GTPBP3 Peptide - middle region

Gene Names
Gtpbp3; AI607903; 2410009F13Rik
Reactivity
Mouse
Synonyms
GTPBP3; GTPBP3 Peptide - middle region; GTPBP3 blocking peptide
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: QALRQLDGELSQLCQGWAKTLTKALAYVEAYIDFGEDDNLEEGVLEQADR
Sequence Length
492
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for GTPBP3 blocking peptide
This is a synthetic peptide designed for use in combination with anti- GTPBP3 Antibody, made

Target Description: GTPase involved in the 5-carboxymethylaminomethyl modification (mnm5s2U34) of the wobble uridine base in mitochondrial tRNAs.
Product Categories/Family for GTPBP3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
tRNA modification GTPase GTPBP3, mitochondrial
NCBI Official Synonym Full Names
GTP binding protein 3
NCBI Official Symbol
Gtpbp3
NCBI Official Synonym Symbols
AI607903; 2410009F13Rik
NCBI Protein Information
tRNA modification GTPase GTPBP3, mitochondrial
UniProt Protein Name
tRNA modification GTPase GTPBP3, mitochondrial
Protein Family
UniProt Gene Name
Gtpbp3
UniProt Entry Name
GTPB3_MOUSE

Research Articles on GTPBP3

Similar Products

Product Notes

The GTPBP3 gtpbp3 (Catalog #AAA3248369) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The GTPBP3 Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: QALRQLDGEL SQLCQGWAKT LTKALAYVEA YIDFGEDDNL EEGVLEQADR. It is sometimes possible for the material contained within the vial of "GTPBP3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual