Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ANXA5 blocking peptide

ANXA5 Peptide - C-terminal region

Gene Names
Anxa5; Anx5; R74653
Reactivity
Mouse
Synonyms
ANXA5; ANXA5 Peptide - C-terminal region; ANXA5 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLL
Sequence Length
319
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ANXA5 blocking peptide
This is a synthetic peptide designed for use in combination with anti- ANXA5 Antibody, made

Target Description: This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
Product Categories/Family for ANXA5 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
annexin A5
NCBI Official Synonym Full Names
annexin A5
NCBI Official Symbol
Anxa5
NCBI Official Synonym Symbols
Anx5; R74653
NCBI Protein Information
annexin A5
UniProt Protein Name
Annexin A5
Protein Family
UniProt Gene Name
Anxa5
UniProt Synonym Gene Names
Anx5; CBP-I; PP4; PAP-I; VAC-alpha
UniProt Entry Name
ANXA5_MOUSE

Uniprot Description

ANXA5: a calcium/phospholipid-binding protein and an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. The binding of labeled ANXA5 to phosphatidylserine is used as a marker of apoptosis. Annexins are a family of structurally related proteins whose common property is calcium-dependent binding to phospholipids. There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1, A2 and A5) appear to be secreted in a physiologically regulated fashion.

Protein type: Apoptosis; Calcium-binding; Inhibitor; Lipid-binding

Cellular Component: cell projection; cell soma; cytoplasm; cytosol; dendrite; endoplasmic reticulum; external side of plasma membrane; extracellular space; focal adhesion; intracellular; membrane; nerve terminal; nucleus; perikaryon; plasma membrane; sarcolemma; synaptic vesicle; Z disc

Molecular Function: calcium-dependent phospholipid binding; calcium-transporting ATPase activity; peptide hormone binding; protein binding; receptor tyrosine kinase binding

Biological Process: negative regulation of blood coagulation; positive regulation of apoptosis; protein homooligomerization; response to calcium ion; response to organic substance

Research Articles on ANXA5

Similar Products

Product Notes

The ANXA5 anxa5 (Catalog #AAA3248304) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ANXA5 Peptide - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: DDHTLIRVVV SRSEIDLFNI RKEFRKNFAT SLYSMIKGDT SGDYKKALLL. It is sometimes possible for the material contained within the vial of "ANXA5, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.