BUB3 blocking peptide
BUB3 Peptide - N-terminal region
Gene Names
Bub3; C78067; AU019800; AU021329; AU043350; AW146323
Reactivity
Mouse
Synonyms
BUB3; BUB3 Peptide - N-terminal region; BUB3 blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: TGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRL
Sequence Length
326
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for BUB3 blocking peptide
This is a synthetic peptide designed for use in combination with anti- BUB3 Antibody, made
Target Description: This gene encodes a component of the mitotic spindle assembly complex. The encoded protein is involved in the regulation of chromosome segregation during oocyte meiosis. Disruption of this gene results in the accumulation of mitotic errors and is lethal in the embryonic stage. Alternative splicing results in multiple transcript variants.
Target Description: This gene encodes a component of the mitotic spindle assembly complex. The encoded protein is involved in the regulation of chromosome segregation during oocyte meiosis. Disruption of this gene results in the accumulation of mitotic errors and is lethal in the embryonic stage. Alternative splicing results in multiple transcript variants.
Product Categories/Family for BUB3 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa
NCBI Official Full Name
mitotic checkpoint protein BUB3
NCBI Official Synonym Full Names
BUB3 mitotic checkpoint protein
NCBI Official Symbol
Bub3
NCBI Official Synonym Symbols
C78067; AU019800; AU021329; AU043350; AW146323
NCBI Protein Information
mitotic checkpoint protein BUB3
UniProt Protein Name
Mitotic checkpoint protein BUB3
Protein Family
UniProt Gene Name
Bub3
UniProt Entry Name
BUB3_MOUSE
NCBI Description
This gene encodes a component of the mitotic spindle assembly complex. The encoded protein is involved in the regulation of chromosome segregation during oocyte meiosis. Disruption of this gene results in the accumulation of mitotic errors and is lethal in the embryonic stage. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015]
Research Articles on BUB3
Similar Products
Product Notes
The BUB3 bub3 (Catalog #AAA3248262) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The BUB3 Peptide - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: TGSNEFKLNQ PPEDGISSVK FSPNTSQFLL VSSWDTSVRL YDVPANSMRL. It is sometimes possible for the material contained within the vial of "BUB3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
