Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CCR1 blocking peptide

CCR1 Peptide - middle region

Gene Names
Ccr1; Cmkbr1; Mip-1a-R
Reactivity
Mouse
Synonyms
CCR1; CCR1 Peptide - middle region; CCR1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: MQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLL
Sequence Length
355
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CCR1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- CCR1 Antibody, made

Target Description: Receptor for a C-C type chemokine. Binds to MIP-1-alpha, RANTES, and less efficiently, to MIP-1-beta or MCP-1 and subsequently transduces a signal by increasing the intracellular calcium ions level. Responsible for affecting stem cell proliferation.
Product Categories/Family for CCR1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39 kDa
NCBI Official Full Name
C-C chemokine receptor type 1
NCBI Official Synonym Full Names
chemokine (C-C motif) receptor 1
NCBI Official Symbol
Ccr1
NCBI Official Synonym Symbols
Cmkbr1; Mip-1a-R
NCBI Protein Information
C-C chemokine receptor type 1
UniProt Protein Name
C-C chemokine receptor type 1
Protein Family
UniProt Gene Name
Ccr1
UniProt Synonym Gene Names
Cmkbr1; C-C CKR-1; CC-CKR-1; CCR-1; CCR1; MIP-1alpha-R
UniProt Entry Name
CCR1_MOUSE

Uniprot Description

CCR1: Receptor for a C-C type chemokine. Binds to MIP-1-alpha, MIP-1-delta, RANTES, and MCP-3 and, less efficiently, to MIP-1- beta or MCP-1 and subsequently transduces a signal by increasing the intracellular calcium ions level. Responsible for affecting stem cell proliferation. Belongs to the G-protein coupled receptor 1 family.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1

Cellular Component: cell soma; external side of plasma membrane; plasma membrane

Molecular Function: C-C chemokine binding; C-C chemokine receptor activity; chemokine receptor activity; phosphoinositide phospholipase C activity; protein binding

Biological Process: calcium ion transport; cell-cell signaling; cellular calcium ion homeostasis; elevation of cytosolic calcium ion concentration; exocytosis; immune response; inflammatory response; leukocyte chemotaxis; myeloid cell differentiation; negative regulation of bone mineralization; negative regulation of innate immune response; positive regulation of calcium ion transport; positive regulation of cell migration; positive regulation of osteoclast differentiation

Research Articles on CCR1

Similar Products

Product Notes

The CCR1 ccr1 (Catalog #AAA3248206) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CCR1 Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: MQHRRLQSMT SIYLFNLAVS DLVFLFTLPF WIDYKLKDDW IFGDAMCKLL. It is sometimes possible for the material contained within the vial of "CCR1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.