SYT11 blocking peptide

SYT11 Peptide - middle region

Cat. Num. AAA3247354

• Gene Names: SYT11; SYT12; sytXI
• Reactivity: Human
• Synonyms: SYT11; SYT11 Peptide - middle region; SYT11 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: KFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGL
• Sequence Length: 431

• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for SYT11 blocking peptide

This is a synthetic peptide designed for use in combination with anti- SYT11 Antibody, made

Target Description: This gene is a member of the synaptotagmin gene family and encodes a protein similar to other family members that are known calcium sensors and mediate calcium-dependent regulation of membrane trafficking in synaptic transmission. The encoded protein is also a substrate for ubiquitin-E3-ligase parkin. The gene has previously been referred to as synaptotagmin XII but has been renamed synaptotagmin XI to be consistent with mouse and rat official nomenclature.

Product Categories/Family for SYT11 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 216548478
• NCBI GeneID: 23208
• NCBI Accession #: NP_689493.3
• NCBI GenBank Nucleotide #: NM_152280.4
• UniProt Accession #: Q9BT88
• Molecular Weight: 48 kDa
• NCBI Official Full Name: synaptotagmin-11
• NCBI Official Synonym Full Names: synaptotagmin 11
• NCBI Official Symbol: SYT11
• NCBI Official Synonym Symbols: SYT12; sytXI
• NCBI Protein Information: synaptotagmin-11
• UniProt Protein Name: Synaptotagmin-11
• Protein Family: Synaptotagmin
• UniProt Gene Name: SYT11
• UniProt Synonym Gene Names: KIAA0080; SytXI
• UniProt Entry Name: SYT11_HUMAN

NCBI Description

This gene is a member of the synaptotagmin gene family and encodes a protein similar to other family members that are known calcium sensors and mediate calcium-dependent regulation of membrane trafficking in synaptic transmission. The encoded protein is also a substrate for ubiquitin-E3-ligase parkin. The gene has previously been referred to as synaptotagmin XII but has been renamed synaptotagmin XI to be consistent with mouse and rat official nomenclature. [provided by RefSeq, Apr 2010]

Uniprot Description

SYT11: May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Belongs to the synaptotagmin family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q21.2

Cellular Component: synaptic vesicle; synaptic vesicle membrane; integral to plasma membrane; cell junction

Molecular Function: protein binding; calcium-dependent phospholipid binding; transporter activity; calcium ion binding

Biological Process: transport; negative regulation of neurotransmitter secretion