Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

USP15 blocking peptide

USP15 Peptide - middle region

Gene Names
USP15; UNPH4; UNPH-2
Reactivity
Human
Synonyms
USP15; USP15 Peptide - middle region; USP15 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: CLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPL
Sequence Length
981
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for USP15 blocking peptide
This is a synthetic peptide designed for use in combination with anti- USP15 Antibody, made

Target Description: This gene encodes a member of the ubiquitin specific protease (USP) family of deubiquitinating enzymes. USP enzymes play critical roles in ubiquitin-dependent processes through polyubiquitin chain disassembly and hydrolysis of ubiquitin-substrate bonds. The encoded protein associates with the COP9 signalosome, and also plays a role in transforming growth factor beta signalling through deubiquitination of receptor-activated SMAD transcription factors. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 2.
Product Categories/Family for USP15 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107 kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 15 isoform 1
NCBI Official Synonym Full Names
ubiquitin specific peptidase 15
NCBI Official Symbol
USP15
NCBI Official Synonym Symbols
UNPH4; UNPH-2
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 15
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 15
UniProt Gene Name
USP15
UniProt Synonym Gene Names
KIAA0529
UniProt Entry Name
UBP15_HUMAN

NCBI Description

This gene encodes a member of the ubiquitin specific protease (USP) family of deubiquitinating enzymes. USP enzymes play critical roles in ubiquitin-dependent processes through polyubiquitin chain disassembly and hydrolysis of ubiquitin-substrate bonds. The encoded protein associates with the COP9 signalosome, and also plays a role in transforming growth factor beta signalling through deubiquitination of receptor-activated SMAD transcription factors. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 2. [provided by RefSeq, Nov 2011]

Uniprot Description

USP15: Protease that degrades 'Lys-48'-linked polyubiquitin chains. Protects target proteins against proteasomal degradation. Protects APC and human papillomavirus type 16 protein E6 against degradation via the ubiquitin proteasome pathway. Belongs to the peptidase C19 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; Ubiquitin-specific protease; EC 3.4.19.12; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 12q14

Cellular Component: cytoplasm; nucleus

Molecular Function: identical protein binding; protein binding; cysteine-type endopeptidase activity; ubiquitin-specific protease activity; SMAD binding; transforming growth factor beta receptor binding

Biological Process: BMP signaling pathway; proteasomal ubiquitin-dependent protein catabolic process; protein deubiquitination; transforming growth factor beta receptor signaling pathway; negative regulation of transforming growth factor beta receptor signaling pathway

Research Articles on USP15

Similar Products

Product Notes

The USP15 usp15 (Catalog #AAA3247179) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The USP15 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: CLPSYTAYKN YDYSEPGRNN EQPGLCGLSN LGNTCFMNSA IQCLSNTPPL. It is sometimes possible for the material contained within the vial of "USP15, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.