Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CAMKK2 blocking peptide

CAMKK2 Peptide - middle region

Gene Names
CAMKK2; CAMKK; CAMKKB
Reactivity
Human
Synonyms
CAMKK2; CAMKK2 Peptide - middle region; CAMKK2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: TLVEVTEEEVENSVKHIPSLATVILVKTMIRKRSFGNPFEGSRREERSLS
Sequence Length
490
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CAMKK2 blocking peptide
This is a synthetic peptide designed for use in combination with anti- CAMKK2 Antibody, made

Target Description: The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. The major isoform of this gene plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Protein products of this gene also phosphorylate AMP-activated protein kinase (AMPK). This gene has its strongest expression in the brain and influences signalling cascades involved with learning and memory, neuronal differentiation and migration, neurite outgrowth, and synapse formation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. The identified isoforms differ in their ability to undergo autophosphorylation and to phosphorylate downstream kinases.
Product Categories/Family for CAMKK2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
calcium/calmodulin-dependent protein kinase kinase 2 isoform 1
NCBI Official Synonym Full Names
calcium/calmodulin dependent protein kinase kinase 2
NCBI Official Symbol
CAMKK2
NCBI Official Synonym Symbols
CAMKK; CAMKKB
NCBI Protein Information
calcium/calmodulin-dependent protein kinase kinase 2
UniProt Protein Name
Calcium/calmodulin-dependent protein kinase kinase 2
UniProt Gene Name
CAMKK2
UniProt Synonym Gene Names
CAMKKB; KIAA0787; CaM-KK 2; CaM-kinase kinase 2; CaMKK 2; CaM-KK beta; CaM-kinase kinase beta; CaMKK beta
UniProt Entry Name
KKCC2_HUMAN

NCBI Description

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. The major isoform of this gene plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Protein products of this gene also phosphorylate AMP-activated protein kinase (AMPK). This gene has its strongest expression in the brain and influences signalling cascades involved with learning and memory, neuronal differentiation and migration, neurite outgrowth, and synapse formation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. The identified isoforms differ in their ability to undergo autophosphorylation and to phosphorylate downstream kinases. [provided by RefSeq, Jul 2012]

Uniprot Description

CAMKK2: Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin- binding domain are inactive. Seems to be involved in hippocampal activation of CREB1. Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Autophagy; Protein kinase, Other; EC 2.7.11.17; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Other group; CAMKK family; Meta subfamily

Chromosomal Location of Human Ortholog: 12q24.2

Cellular Component: cell projection; cytoplasm; intracellular; nucleus

Molecular Function: calmodulin binding; calmodulin-dependent protein kinase activity; protein-tyrosine kinase activity; calcium ion binding; ATP binding

Biological Process: peptidyl-tyrosine phosphorylation; positive regulation of transcription, DNA-dependent; protein amino acid autophosphorylation; MAPKKK cascade; calcium-mediated signaling; regulation of protein kinase activity; protein amino acid phosphorylation

Research Articles on CAMKK2

Similar Products

Product Notes

The CAMKK2 camkk2 (Catalog #AAA3247119) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CAMKK2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLVEVTEEEV ENSVKHIPSL ATVILVKTMI RKRSFGNPFE GSRREERSLS. It is sometimes possible for the material contained within the vial of "CAMKK2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.