PCTP blocking peptide
PCTP Peptide - middle region
Gene Names
PCTP; PC-TP; STARD2
Reactivity
Human
Synonyms
PCTP; PCTP Peptide - middle region; PCTP blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRD
Sequence Length
142
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PCTP blocking peptide
This is a synthetic peptide designed for use in combination with anti- PCTP Antibody, made
Target Description: Catalyzes the transfer of phosphatidylcholine between membranes. Binds a single lipid molecule.
Target Description: Catalyzes the transfer of phosphatidylcholine between membranes. Binds a single lipid molecule.
Product Categories/Family for PCTP blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15 kDa
NCBI Official Full Name
phosphatidylcholine transfer protein isoform 2
NCBI Official Synonym Full Names
phosphatidylcholine transfer protein
NCBI Official Symbol
PCTP
NCBI Official Synonym Symbols
PC-TP; STARD2
NCBI Protein Information
phosphatidylcholine transfer protein
UniProt Protein Name
Phosphatidylcholine transfer protein
Protein Family
UniProt Gene Name
PCTP
UniProt Synonym Gene Names
STARD2; PC-TP; StARD2
UniProt Entry Name
PPCT_HUMAN
Uniprot Description
PCTP: Catalyzes the transfer of phosphatidylcholine between membranes. Binds a single lipid molecule. 2 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 17q21-q24
Cellular Component: cytosol
Molecular Function: phosphatidylcholine transmembrane transporter activity; phosphatidylcholine binding
Biological Process: cholesterol metabolic process; phospholipid transport; lipid transport
Research Articles on PCTP
Similar Products
Product Notes
The PCTP pctp (Catalog #AAA3246503) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PCTP Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPTLLADIYM DSDYRKQWDQ YVKELYEQEC NGETVVYWEV KYPFPMSNRD. It is sometimes possible for the material contained within the vial of "PCTP, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
