Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

LPCAT4 blocking peptide

LPCAT4 Peptide - middle region

Gene Names
LPCAT4; AYTL3; AGPAT7; LPEAT2; LPAAT-eta
Reactivity
Human
Synonyms
LPCAT4; LPCAT4 Peptide - middle region; LPCAT4 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VQPVLIRYPNSLDTTSWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYHPS
Sequence Length
524
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for LPCAT4 blocking peptide
This is a synthetic peptide designed for use in combination with anti- LPCAT4 Antibody, made

Target Description: Members of the 1-acylglycerol-3-phosphate O-acyltransferase family, such as AGPAT7, catalyze the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA), a precursor in the biosynthesis of all glycerolipids. Both LPA and PA are involved in signal transduction.
Product Categories/Family for LPCAT4 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57 kDa
NCBI Official Full Name
lysophospholipid acyltransferase LPCAT4
NCBI Official Synonym Full Names
lysophosphatidylcholine acyltransferase 4
NCBI Official Symbol
LPCAT4
NCBI Official Synonym Symbols
AYTL3; AGPAT7; LPEAT2; LPAAT-eta
NCBI Protein Information
lysophospholipid acyltransferase LPCAT4
UniProt Protein Name
Lysophospholipid acyltransferase LPCAT4
UniProt Gene Name
LPCAT4
UniProt Synonym Gene Names
AGPAT7; AYTL3; LPEAT2; 1-AGP acyltransferase 7; 1-AGPAT 7
UniProt Entry Name
LPCT4_HUMAN

NCBI Description

Members of the 1-acylglycerol-3-phosphate O-acyltransferase (EC 2.3.1.51) family, such as AGPAT7, catalyze the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA), a precursor in the biosynthesis of all glycerolipids. Both LPA and PA are involved in signal transduction (Ye et al., 2005 [PubMed 16243729]).[supplied by OMIM, May 2008]

Uniprot Description

AGPAT7: Displays acyl-CoA-dependent lysophospholipid acyltransferase activity with a subset of lysophospholipids as substrates; converts lysophosphatidylethanolamine to phosphatidylethanolamine, lysophosphatidylcholine to phosphatidycholine, 1-alkenyl-lysophatidylethanolamine to 1- alkenyl-phosphatidylethanolamine, lysophosphatidylglycerol and alkyl-lysophosphatidylcholine to phosphatidylglycerol and alkyl- phosphatidylcholine, respectively. In contrast, has no lysophosphatidylinositol, glycerol-3-phosphate, diacylglycerol or lysophosphatidic acid acyltransferase activity. Prefers long chain acyl-CoAs (C16, C18) as acyl donors. Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.

Protein type: Transferase; EC 2.3.1.67; Membrane protein, integral; EC 2.3.1.121; EC 2.3.1.n6; EC 2.3.1.n7; Membrane protein, multi-pass; EC 2.3.1.23

Chromosomal Location of Human Ortholog: 15q14

Cellular Component: endoplasmic reticulum membrane; membrane; endoplasmic reticulum; integral to membrane

Molecular Function: 1-alkylglycerophosphocholine O-acetyltransferase activity; 1-acylglycerophosphocholine O-acyltransferase activity; 1-alkenylglycerophosphoethanolamine O-acyltransferase activity

Biological Process: phospholipid metabolic process; glycerophospholipid biosynthetic process; phosphatidic acid biosynthetic process; triacylglycerol biosynthetic process; cellular lipid metabolic process

Research Articles on LPCAT4

Similar Products

Product Notes

The LPCAT4 lpcat4 (Catalog #AAA3246059) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The LPCAT4 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: VQPVLIRYPN SLDTTSWAWR GPGVLKVLWL TASQPCSIVD VEFLPVYHPS. It is sometimes possible for the material contained within the vial of "LPCAT4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.