DCLRE1A blocking peptide
DCLRE1A Peptide - N-terminal region
Gene Names
DCLRE1A; PSO2; SNM1; SNM1A
Reactivity
Human
Applications
Western Blot
Synonyms
DCLRE1A; DCLRE1A Peptide - N-terminal region; DCLRE1A blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LEDISEEDIWEYKSKRKPKRVDPNNGSKNILKSVEKATDGKYQSKRSRNR
Sequence Length
1040
Applicable Applications for DCLRE1A blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DCLRE1A blocking peptide
This is a synthetic peptide designed for use in combination with anti-DCLRE1A Antibody, made
Target Description: This gene encodes a conserved protein that is involved in the repair of DNA interstrand cross-links. DNA cross-links suppress transcription, replication, and DNA segregation. The encoded protein is a regulator of the mitotic cell cycle checkpoint. Alternative splicing results in multiple transcript variants.
Target Description: This gene encodes a conserved protein that is involved in the repair of DNA interstrand cross-links. DNA cross-links suppress transcription, replication, and DNA segregation. The encoded protein is a regulator of the mitotic cell cycle checkpoint. Alternative splicing results in multiple transcript variants.
Product Categories/Family for DCLRE1A blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
114 kDa
NCBI Official Full Name
DNA cross-link repair 1A protein
NCBI Official Synonym Full Names
DNA cross-link repair 1A
NCBI Official Symbol
DCLRE1A
NCBI Official Synonym Symbols
PSO2; SNM1; SNM1A
NCBI Protein Information
DNA cross-link repair 1A protein
UniProt Protein Name
DNA cross-link repair 1A protein
Protein Family
UniProt Gene Name
DCLRE1A
UniProt Synonym Gene Names
KIAA0086; SNM1; SNM1A; hSNM1; hSNM1A
UniProt Entry Name
DCR1A_HUMAN
NCBI Description
This gene encodes a conserved protein that is involved in the repair of DNA interstrand cross-links. DNA cross-links suppress transcription, replication, and DNA segregation. The encoded protein is a regulator of the mitotic cell cycle checkpoint. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]
Uniprot Description
DCLRE1A: May be required for DNA interstrand cross-link repair. Also required for checkpoint mediated cell cycle arrest in early prophase in response to mitotic spindle poisons. Belongs to the DNA repair metallo-beta-lactamase (DRMBL) family.
Chromosomal Location of Human Ortholog: 10q25.1
Cellular Component: nucleolus; nucleus
Biological Process: mitosis; cell division; nucleotide-excision repair
Research Articles on DCLRE1A
Similar Products
Product Notes
The DCLRE1A dclre1a (Catalog #AAA3245746) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DCLRE1A Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DCLRE1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DCLRE1A dclre1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEDISEEDIW EYKSKRKPKR VDPNNGSKNI LKSVEKATDG KYQSKRSRNR. It is sometimes possible for the material contained within the vial of "DCLRE1A, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
