Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ACOT1 blocking peptide

ACOT1 Peptide - middle region

Gene Names
ACOT1; ACH2; CTE-1; LACH2
Reactivity
Human
Applications
Western Blot
Synonyms
ACOT1; ACOT1 Peptide - middle region; ACOT1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKPQIICYPETG
Sequence Length
421
Applicable Applications for ACOT1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ACOT1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ACOT1 Antibody, made
Product Categories/Family for ACOT1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46 kDa
NCBI Official Full Name
acyl-coenzyme A thioesterase 1
NCBI Official Synonym Full Names
acyl-CoA thioesterase 1
NCBI Official Symbol
ACOT1
NCBI Official Synonym Symbols
ACH2; CTE-1; LACH2
NCBI Protein Information
acyl-coenzyme A thioesterase 1
UniProt Protein Name
Acyl-coenzyme A thioesterase 1
UniProt Gene Name
ACOT1
UniProt Synonym Gene Names
CTE1; Acyl-CoA thioesterase 1
UniProt Entry Name
ACOT1_HUMAN

Uniprot Description

ACOT1: Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Active towards fatty acyl-CoA with chain-lengths of C12-C16. Belongs to the C/M/P thioester hydrolase family.

Protein type: EC 3.1.2.2; Lipid Metabolism - unsaturated fatty acid biosynthesis; Hydrolase

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: cytosol

Molecular Function: acyl-CoA hydrolase activity; palmitoyl-CoA hydrolase activity

Biological Process: acyl-CoA metabolic process; very-long-chain fatty acid metabolic process; long-chain fatty acid metabolic process

Similar Products

Product Notes

The ACOT1 acot1 (Catalog #AAA3245730) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ACOT1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACOT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACOT1 acot1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PVERAESTFL FLVGQDDHNW KSEFYANEAC KRLQAHGRRK PQIICYPETG. It is sometimes possible for the material contained within the vial of "ACOT1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.