Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RSL24D1 blocking peptide

RSL24D1 Peptide - N-terminal region

Gene Names
RSL24D1; L30; RLP24; RPL24; TVAS3; RPL24L; C15orf15; HRP-L30-iso
Reactivity
Human
Synonyms
RSL24D1; RSL24D1 Peptide - N-terminal region; RSL24D1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: IYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKE
Sequence Length
163
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RSL24D1 blocking peptide
This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The protein encoded by this gene localizes to the nucleolus and is thought to play a role in the biogenesis of the 60S ribosomal subunit. The precise function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals and has multiple pseudogenes.
Product Categories/Family for RSL24D1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
probable ribosome biogenesis protein RLP24
NCBI Official Synonym Full Names
ribosomal L24 domain containing 1
NCBI Official Symbol
RSL24D1
NCBI Official Synonym Symbols
L30; RLP24; RPL24; TVAS3; RPL24L; C15orf15; HRP-L30-iso
NCBI Protein Information
probable ribosome biogenesis protein RLP24
UniProt Protein Name
Probable ribosome biogenesis protein RLP24
UniProt Gene Name
RSL24D1
UniProt Synonym Gene Names
C15orf15; RPL24L
UniProt Entry Name
RLP24_HUMAN

NCBI Description

This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The protein encoded by this gene localizes to the nucleolus and is thought to play a role in the biogenesis of the 60S ribosomal subunit. The precise function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals and has multiple pseudogenes. [provided by RefSeq, Jul 2012]

Uniprot Description

RSL24D1: Involved in the biogenesis of the 60S ribosomal subunit. Ensures the docking of GTPBP4/NOG1 to pre-60S particles. Belongs to the ribosomal protein L24e family.

Protein type: Nucleolus

Chromosomal Location of Human Ortholog: 15q21

Cellular Component: nucleolus; nucleus

Biological Process: ribosome biogenesis and assembly

Research Articles on RSL24D1

Similar Products

Product Notes

The RSL24D1 rsl24d1 (Catalog #AAA3244894) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RSL24D1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: IYPGHGMMFV RNDCKVFRFC KSKCHKNFKK KRNPRKVRWT KAFRKAAGKE. It is sometimes possible for the material contained within the vial of "RSL24D1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.