HINFP blocking peptide
HINFP Peptide - C-terminal region
Gene Names
HINFP; MIZF; HiNF-P; ZNF743
Reactivity
Human
Synonyms
HINFP; HINFP Peptide - C-terminal region; HINFP blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SGHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLNESS
Sequence Length
517
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for HINFP blocking peptide
This is a synthetic peptide designed for use in combination with anti-HINFP Antibody, made
Target Description: HINFP is a transcriptional repressor that binds to the consensus sequence 5'-CGGACGTT-3' and to the RB1 promoter. It is a transcriptional activator that promotes histone H4 gene transcription at the G1/S phase transition in conjunction with NPAT. Also it activates transcription of the ATM and PRKDC genes. HINFP autoregulates its expression by associating with its own promoter.
Target Description: HINFP is a transcriptional repressor that binds to the consensus sequence 5'-CGGACGTT-3' and to the RB1 promoter. It is a transcriptional activator that promotes histone H4 gene transcription at the G1/S phase transition in conjunction with NPAT. Also it activates transcription of the ATM and PRKDC genes. HINFP autoregulates its expression by associating with its own promoter.
Product Categories/Family for HINFP blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
histone H4 transcription factor isoform 1
NCBI Official Synonym Full Names
histone H4 transcription factor
NCBI Official Symbol
HINFP
NCBI Official Synonym Symbols
MIZF; HiNF-P; ZNF743
NCBI Protein Information
histone H4 transcription factor
UniProt Protein Name
Histone H4 transcription factor
Protein Family
UniProt Gene Name
HINFP
UniProt Synonym Gene Names
MIZF; ZNF743
UniProt Entry Name
HINFP_HUMAN
NCBI Description
This gene encodes a transcription factor that interacts with methyl-CpG-binding protein-2 (MBD2), a component of the MeCP1 histone deacetylase (HDAC) complex, and plays a role in DNA methylation and transcription repression. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Aug 2011]
Research Articles on HINFP
Similar Products
Product Notes
The HINFP hinfp (Catalog #AAA3244876) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The HINFP Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGHPRFRYKE HEDGYMRLQL VRYESVELTQ QLLRQPQEGS GLGTSLNESS. It is sometimes possible for the material contained within the vial of "HINFP, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
