GCFC2 blocking peptide

GCFC2 Peptide - middle region

Cat. Num. AAA3244786

• Gene Names: GCFC2; GCF; TCF9; DNABF; C2orf3
• Reactivity: Human
• Synonyms: GCFC2; GCFC2 Peptide - middle region; GCFC2 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: QKQKKVFEEVQDDFCNIQNILLKFQQWREKFPDSYYEAFISLCIPKLLNP
• Sequence Length: 781

• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for GCFC2 blocking peptide

The first mRNA transcript isolated for this gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). A positively charged amino terminus present only in the chimera was determined to bind GC-rich DNA, thus mistakenly thought to identify a transcription factor gene.

Product Categories/Family for GCFC2 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 44890065
• NCBI GeneID: 6936
• NCBI Accession #: NP_003194
• NCBI GenBank Nucleotide #: NM_001201334.1
• UniProt Accession #: P16383
• Molecular Weight: 89 kDa
• NCBI Official Full Name: GC-rich sequence DNA-binding factor 2 isoform 1
• NCBI Official Synonym Full Names: GC-rich sequence DNA-binding factor 2
• NCBI Official Symbol: GCFC2
• NCBI Official Synonym Symbols: GCF; TCF9; DNABF; C2orf3
• NCBI Protein Information: GC-rich sequence DNA-binding factor 2
• UniProt Protein Name: GC-rich sequence DNA-binding factor 2
• Protein Family: GC-rich sequence DNA-binding factor
• UniProt Gene Name: GCFC2
• UniProt Synonym Gene Names: C2orf3; GCF; TCF9; TCF-9
• UniProt Entry Name: GCFC2_HUMAN

NCBI Description

The first mRNA transcript isolated for this gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). A positively charged amino terminus present only in the chimera was determined to bind GC-rich DNA, thus mistakenly thought to identify a transcription factor gene. [provided by RefSeq, Jul 2008]

Uniprot Description

TCF9: Factor that represses transcription. It binds to the GC- rich sequences (5'-GCGGGGC-3') present in the epidermal growth factor receptor, beta-actin, and calcium-dependent protease promoters. Belongs to the GCF family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus

Chromosomal Location of Human Ortholog: 2p12

Cellular Component: nucleoplasm; nucleolus; nucleus

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; spliceosome assembly; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent