Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CIRBP blocking peptide

CIRBP Peptide - middle region

Gene Names
CIRBP; CIRP
Reactivity
Human
Applications
Western Blot
Synonyms
CIRBP; CIRBP Peptide - middle region; CIRBP blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGD
Sequence Length
172
Applicable Applications for CIRBP blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CIRBP blocking peptide
This is a synthetic peptide designed for use in combination with anti-CIRBP Antibody, made

Target Description: CIRBP is a cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. It acts as a translational activator. Seems to play an essential role in cold- induced suppression of cell proliferation. It binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. It acts as a translational repressor (By similarity). Promotes assembly of stress granules (SGs), when overexpressed.
Product Categories/Family for CIRBP blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
cold-inducible RNA-binding protein isoform 1
NCBI Official Synonym Full Names
cold inducible RNA binding protein
NCBI Official Symbol
CIRBP
NCBI Official Synonym Symbols
CIRP
NCBI Protein Information
cold-inducible RNA-binding protein
UniProt Protein Name
Cold-inducible RNA-binding protein
UniProt Gene Name
CIRBP
UniProt Synonym Gene Names
A18HNRNP; CIRP
UniProt Entry Name
CIRBP_HUMAN

Uniprot Description

Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (). Promotes assembly of stress granules (SGs), when overexpressed.

Research Articles on CIRBP

Similar Products

Product Notes

The CIRBP cirbp (Catalog #AAA3244304) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CIRBP Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CIRBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CIRBP cirbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SVDGRQIRVD QAGKSSDNRS RGYRGGSAGG RGFFRGGRGR GRGFSRGGGD. It is sometimes possible for the material contained within the vial of "CIRBP, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.