G3BP2 blocking peptide
G3BP2 Peptide - middle region
Reactivity
Human
Applications
Western Blot
Synonyms
G3BP2; G3BP2 Peptide - middle region; G3BP2 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: QRPRERPGFPPRGPRPGRGDMEQNDSDNRRIIRYPDSHQLFVGNLPHDID
Sequence Length
449
Applicable Applications for G3BP2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for G3BP2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-G3BP2 Antibody, made
Target Description: G3BP2 is a probable scaffold protein that may be involved in mRNA transport.
Target Description: G3BP2 is a probable scaffold protein that may be involved in mRNA transport.
Product Categories/Family for G3BP2 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
ras GTPase-activating protein-binding protein 2 isoform a
NCBI Official Synonym Full Names
G3BP stress granule assembly factor 2
NCBI Official Symbol
G3BP2
NCBI Protein Information
ras GTPase-activating protein-binding protein 2
UniProt Protein Name
Ras GTPase-activating protein-binding protein 2
Protein Family
UniProt Gene Name
G3BP2
UniProt Synonym Gene Names
KIAA0660; G3BP-2
UniProt Entry Name
G3BP2_HUMAN
Uniprot Description
G3BP-2: an hnRNA-binding protein and an element of the Ras signal transduction pathway. A DNA-unwinding enzyme which can unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. Binds specifically to the Ras-GTPase-activating protein (GAP120) by associating with its SH3 domain. Interacts with USP10, and may regulate it. Several alternatively spliced transcript variants have been described.
Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold; RNA-binding
Chromosomal Location of Human Ortholog: 4q21.1
Cellular Component: cytoplasm
Molecular Function: receptor signaling complex scaffold activity; nucleotide binding
Biological Process: mRNA transport; cytoplasmic sequestering of NF-kappaB; Ras protein signal transduction
Research Articles on G3BP2
Similar Products
Product Notes
The G3BP2 g3bp2 (Catalog #AAA3244270) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The G3BP2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's G3BP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the G3BP2 g3bp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QRPRERPGFP PRGPRPGRGD MEQNDSDNRR IIRYPDSHQL FVGNLPHDID. It is sometimes possible for the material contained within the vial of "G3BP2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
