Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

AKAP14 blocking peptide

AKAP14 Peptide - N-terminal region

Gene Names
AKAP14; AKAP28; PRKA14
Reactivity
Human
Applications
Western Blot
Synonyms
AKAP14; AKAP14 Peptide - N-terminal region; AKAP14 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NSTSQKAMDEDNKAASQTMPNTQDKNYEDELTQVALALVEDVINYAVKIV
Sequence Length
89
Applicable Applications for AKAP14 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for AKAP14 blocking peptide
This is a synthetic peptide designed for use in combination with anti-AKAP14 Antibody, made

Target Description: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The protein anchors PKA in ciliary axonemes and, in this way, may play a role in regulating ciliary beat frequency. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product Categories/Family for AKAP14 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9kDa
NCBI Official Full Name
A-kinase anchor protein 14 isoform b
NCBI Official Synonym Full Names
A-kinase anchoring protein 14
NCBI Official Symbol
AKAP14
NCBI Official Synonym Symbols
AKAP28; PRKA14
NCBI Protein Information
A-kinase anchor protein 14
UniProt Protein Name
A-kinase anchor protein 14
Protein Family
UniProt Gene Name
AKAP14
UniProt Synonym Gene Names
AKAP28; AKAP-14; AKAP 28; PRKA14
UniProt Entry Name
AKA28_HUMAN

NCBI Description

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The protein anchors PKA in ciliary axonemes and, in this way, may play a role in regulating ciliary beat frequency. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

AKAP14: Binds to type II regulatory subunits of protein kinase A and anchors/targets them. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: Xq24

Cellular Component: cytoplasm

Molecular Function: protein kinase A binding

Biological Process: spermatogenesis

Research Articles on AKAP14

Similar Products

Product Notes

The AKAP14 akap14 (Catalog #AAA3244233) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The AKAP14 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AKAP14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AKAP14 akap14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NSTSQKAMDE DNKAASQTMP NTQDKNYEDE LTQVALALVE DVINYAVKIV. It is sometimes possible for the material contained within the vial of "AKAP14, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.