SFR1 blocking peptide
SFR1 Peptide - C-terminal region
Gene Names
SFR1; MEI5; MEIR5; C10orf78; bA373N18.1
Reactivity
Human
Applications
Western Blot
Synonyms
SFR1; SFR1 Peptide - C-terminal region; SFR1 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LLIKKWRSCSQLLLYELQSAVSEENKKLSLTQLIDHYGLDDKLLHYNRSE
Sequence Length
232
Applicable Applications for SFR1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SFR1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SFR1 Antibody, made
Target Description: SFR1 is a component of the SWI5-SFR1 complex, a complex required for double-strand break repair via homologous recombination.
Target Description: SFR1 is a component of the SWI5-SFR1 complex, a complex required for double-strand break repair via homologous recombination.
Product Categories/Family for SFR1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
swi5-dependent recombination DNA repair protein 1 homolog isoform a
NCBI Official Synonym Full Names
SWI5 dependent homologous recombination repair protein 1
NCBI Official Symbol
SFR1
NCBI Official Synonym Symbols
MEI5; MEIR5; C10orf78; bA373N18.1
NCBI Protein Information
swi5-dependent recombination DNA repair protein 1 homolog
UniProt Protein Name
Swi5-dependent recombination DNA repair protein 1 homolog
Protein Family
UniProt Gene Name
SFR1
UniProt Synonym Gene Names
C10orf78; MEI5; MEIR5
UniProt Entry Name
SFR1_HUMAN
Uniprot Description
SFR1: Component of the SWI5-SFR1 complex, a complex required for double-strand break repair via homologous recombination. Belongs to the SFR1/MEI5 family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 10q25.1
Cellular Component: nucleus
Molecular Function: protein binding
Biological Process: double-strand break repair via homologous recombination
Research Articles on SFR1
Similar Products
Product Notes
The SFR1 sfr1 (Catalog #AAA3243525) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SFR1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SFR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SFR1 sfr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLIKKWRSCS QLLLYELQSA VSEENKKLSL TQLIDHYGLD DKLLHYNRSE. It is sometimes possible for the material contained within the vial of "SFR1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
