Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DSCC1 blocking peptide

DSCC1 Peptide - middle region

Gene Names
DSCC1; DCC1
Reactivity
Human
Applications
Western Blot
Synonyms
DSCC1; DSCC1 Peptide - middle region; DSCC1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: MENPYEGPDSQKEKDSNSSKYTTEDLLDQIQASEEEIMTQLQVLNACKIG
Sequence Length
393
Applicable Applications for DSCC1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DSCC1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-DSCC1 Antibody, made

Target Description: CHTF18, CHTF8, and DSCC1 are components of an alternative replication factor C (RFC) complex that loads PCNA onto DNA during S phase of the cell cycle.
Product Categories/Family for DSCC1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
sister chromatid cohesion protein DCC1
NCBI Official Synonym Full Names
DNA replication and sister chromatid cohesion 1
NCBI Official Symbol
DSCC1
NCBI Official Synonym Symbols
DCC1
NCBI Protein Information
sister chromatid cohesion protein DCC1
UniProt Protein Name
Sister chromatid cohesion protein DCC1
UniProt Gene Name
DSCC1
UniProt Synonym Gene Names
DCC1; UNQ9337/PRO34008
UniProt Entry Name
DCC1_HUMAN

NCBI Description

CHTF18 (MIM 613201), CHTF8 (MIM 613202), and DSCC1 are components of an alternative replication factor C (RFC) (see MIM 600404) complex that loads PCNA (MIM 176740) onto DNA during S phase of the cell cycle (Merkle et al., 2003 [PubMed 12766176]; Bermudez et al., 2003 [PubMed 12930902]).[supplied by OMIM, Dec 2009]

Research Articles on DSCC1

Similar Products

Product Notes

The DSCC1 dscc1 (Catalog #AAA3243289) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DSCC1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DSCC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DSCC1 dscc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MENPYEGPDS QKEKDSNSSK YTTEDLLDQI QASEEEIMTQ LQVLNACKIG. It is sometimes possible for the material contained within the vial of "DSCC1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.