PLD6 blocking peptide
PLD6 Peptide - C-terminal region
Gene Names
PLD6; ZUC
Reactivity
Human
Applications
Western Blot
Synonyms
PLD6; PLD6 Peptide - C-terminal region; PLD6 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
ITEDDEYVRLFLEEFERIWEQFNPTKYTFFPPKKSHGSCAPPVSRAGGRL
Sequence Length
252
Applicable Applications for PLD6 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PLD6 blocking peptide
This is a synthetic peptide designed for use in combination with anti-PLD6 Antibody, made
Target Description: PLD6 is a cardiolipin hydrolase present at the mitochondrial outer membrane required both for mitochondrial fusion and piRNA metabolic process. PLD6 acts by catalyzing the hydrolysis of cardiolipin (diphosphatidylglycerol) to form phosphatidate (phosphatidic acid or PA) at the mitochondrial outer membrane surface, promoting mitochondrial fusion. The production of phosphatidate also regulates the piRNA metabolic process by promoting recruitment and/or activation of components of the meiotic nuage, also named P granule, a critical step for primary biogenesis of piRNAs. It is required during spermatogenesis to repress transposable elements and prevent their mobilization via its role in the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons.
Target Description: PLD6 is a cardiolipin hydrolase present at the mitochondrial outer membrane required both for mitochondrial fusion and piRNA metabolic process. PLD6 acts by catalyzing the hydrolysis of cardiolipin (diphosphatidylglycerol) to form phosphatidate (phosphatidic acid or PA) at the mitochondrial outer membrane surface, promoting mitochondrial fusion. The production of phosphatidate also regulates the piRNA metabolic process by promoting recruitment and/or activation of components of the meiotic nuage, also named P granule, a critical step for primary biogenesis of piRNAs. It is required during spermatogenesis to repress transposable elements and prevent their mobilization via its role in the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons.
Product Categories/Family for PLD6 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
mitochondrial cardiolipin hydrolase
NCBI Official Synonym Full Names
phospholipase D family member 6
NCBI Official Symbol
PLD6
NCBI Official Synonym Symbols
ZUC
NCBI Protein Information
mitochondrial cardiolipin hydrolase
UniProt Protein Name
Mitochondrial cardiolipin hydrolase
Protein Family
UniProt Gene Name
PLD6
UniProt Synonym Gene Names
MitoPLD; PLD 6
UniProt Entry Name
PLD6_HUMAN
Research Articles on PLD6
Similar Products
Product Notes
The PLD6 pld6 (Catalog #AAA3243081) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PLD6 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLD6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLD6 pld6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ITEDDEYVRL FLEEFERIWE QFNPTKYTFF PPKKSHGSCA PPVSRAGGRL. It is sometimes possible for the material contained within the vial of "PLD6, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
