LIN54 blocking peptide

LIN54 Peptide - C-terminal region

Cat. Num. AAA3242744

• Gene Names: LIN54; TCX1; JC8.6; CXCDC1; MIP120
• Reactivity: Human
• Applications: Western Blot
• Synonyms: LIN54; LIN54 Peptide - C-terminal region; LIN54 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: TFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINS
• Sequence Length: 528

• Applicable Applications for LIN54 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for LIN54 blocking peptide

This is a synthetic peptide designed for use in combination with anti-LIN54 Antibody, made

Target Description: LIN54 is a component of the LIN, or DREAM, complex, an essential regulator of cell cycle genes.

Product Categories/Family for LIN54 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 169234721
• NCBI GeneID: 132660
• NCBI Accession #: NP_001108479
• NCBI GenBank Nucleotide #: NM_001115007
• UniProt Accession #: Q6MZP7
• Molecular Weight: 58kDa
• NCBI Official Full Name: protein lin-54 homolog isoform b
• NCBI Official Synonym Full Names: lin-54 DREAM MuvB core complex component
• NCBI Official Symbol: LIN54
• NCBI Official Synonym Symbols: TCX1; JC8.6; CXCDC1; MIP120
• NCBI Protein Information: protein lin-54 homolog
• UniProt Protein Name: Protein lin-54 homolog
• Protein Family: Protein
• UniProt Gene Name: LIN54
• UniProt Synonym Gene Names: CXCDC1; KIAA2037
• UniProt Entry Name: LIN54_HUMAN

NCBI Description

LIN54 is a component of the LIN, or DREAM, complex, an essential regulator of cell cycle genes (Schmit et al., 2009 [PubMed 19725879]).[supplied by OMIM, Dec 2010]