Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CD300LB blocking peptide

CD300LB Peptide - middle region

Gene Names
CD300LB; CLM7; CLM-7; IREM3; TREM5; CD300b; IREM-3; TREM-5; CMRF35-A2
Reactivity
Human
Applications
Western Blot
Synonyms
CD300LB; CD300LB Peptide - middle region; CD300LB blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
CRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDA
Sequence Length
238
Applicable Applications for CD300LB blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CD300LB blocking peptide
This is a synthetic peptide designed for use in combination with anti-CD300LB Antibody, made

Target Description: CD300LB is a nonclassical activating receptor of the immunoglobulin (Ig) superfamily expressed on myeloid cells.
Product Categories/Family for CD300LB blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
CMRF35-like molecule 7
NCBI Official Synonym Full Names
CD300 molecule like family member b
NCBI Official Symbol
CD300LB
NCBI Official Synonym Symbols
CLM7; CLM-7; IREM3; TREM5; CD300b; IREM-3; TREM-5; CMRF35-A2
NCBI Protein Information
CMRF35-like molecule 7
UniProt Protein Name
CMRF35-like molecule 7
Protein Family
UniProt Gene Name
CD300LB
UniProt Synonym Gene Names
CD300B; CLM7; CMRF35A2; IREM3; LMIR5; TREM5; CLM-7; IREM-3; TREM-5
UniProt Entry Name
CLM7_HUMAN

NCBI Description

CD300LB is a nonclassical activating receptor of the immunoglobulin (Ig) superfamily expressed on myeloid cells (Martinez-Barriocanal and Sayos, 2006 [PubMed 16920917]).[supplied by OMIM, Mar 2008]

Uniprot Description

Function: Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2. Ref.1 Ref.9

Subunit structure: Interacts with TYROBP, which enhances cell surface expression and activation properties. Interacts with GRB2 in the presence of FYN. Ref.1 Ref.9

Subcellular location: Cell membrane; Single-pass type I membrane protein

By similarity.

Tissue specificity: Expressed exclusively in myeloid lineages. Ref.1

Post-translational modification: Phosphorylation on Tyr-188 by FYN is required for interaction with GRB2.

Sequence similarities: Belongs to the CD300 family.Contains 1 Ig-like V-type (immunoglobulin-like) domain.

Sequence caution: The sequence AAH28091.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.The sequence BAF83614.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.The sequence EAW89170.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Research Articles on CD300LB

Similar Products

Product Notes

The CD300LB cd300lb (Catalog #AAA3242650) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CD300LB Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD300LB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD300LB cd300lb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CRGVRWDTCK ILIETRGSEQ GEKSDRVSIK DNQKDRTFTV TMEGLRRDDA. It is sometimes possible for the material contained within the vial of "CD300LB, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.