Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DNAJC7 blocking peptide

DNAJC7 Peptide - C-terminal region

Gene Names
DNAJC7; DJ11; DJC7; TPR2; TTC2
Reactivity
Human
Applications
Western Blot
Synonyms
DNAJC7; DNAJC7 Peptide - C-terminal region; DNAJC7 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
KTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMH
Sequence Length
494
Applicable Applications for DNAJC7 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DNAJC7 blocking peptide
This is a synthetic peptide designed for use in combination with anti-DNAJC7 Antibody, made

Target Description: This gene encodes a member of the DNAJ heat shock protein 40 family of proteins that is characterized by two N-terminal tetratricopeptide repeat domains and a C-terminal DNAJ domain. This protein binds the chaperone proteins heat shock proteins 70 and 90 in an ATP-dependent manner and may function as a co-chaperone. Pseudogenes of this gene are found on chromosomes 1 and 6. Alternate splicing results in multiple transcript variants.
Product Categories/Family for DNAJC7 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
dnaJ homolog subfamily C member 7 isoform 1
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member C7
NCBI Official Symbol
DNAJC7
NCBI Official Synonym Symbols
DJ11; DJC7; TPR2; TTC2
NCBI Protein Information
dnaJ homolog subfamily C member 7
UniProt Protein Name
DnaJ homolog subfamily C member 7
Protein Family
UniProt Gene Name
DNAJC7
UniProt Synonym Gene Names
TPR2; TTC2; TPR repeat protein 2
UniProt Entry Name
DNJC7_HUMAN

NCBI Description

This gene encodes a member of the DNAJ heat shock protein 40 family of proteins that is characterized by two N-terminal tetratricopeptide repeat domains and a C-terminal DNAJ domain. This protein binds the chaperone proteins heat shock proteins 70 and 90 in an ATP-dependent manner and may function as a co-chaperone. Pseudogenes of this gene are found on chromosomes 1 and 6. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009]

Uniprot Description

DNAJC7: a co-chaperone protein that binds both Hsp70 and Hsp90 through its TPR domains. Its DnaJ domain stimulates ATP hydrolysis and polypeptide binding by Hsp70. Interacts with the proapoptotic and cell-cycle checkpoint protein Rad9. Rad9 transiently dissociates from Tpr2 following heat-shock or UV treatments.

Protein type: Chaperone

Chromosomal Location of Human Ortholog: 17q21.2

Cellular Component: nucleoplasm; cytoskeleton; membrane; cytoplasm

Molecular Function: protein binding; heat shock protein binding

Biological Process: protein folding

Research Articles on DNAJC7

Similar Products

Product Notes

The DNAJC7 dnajc7 (Catalog #AAA3241717) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DNAJC7 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DNAJC7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DNAJC7 dnajc7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KTKEHKQLLK NAQLELKKSK RKDYYKILGV DKNASEDEIK KAYRKRALMH. It is sometimes possible for the material contained within the vial of "DNAJC7, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.