Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATG13 blocking peptide

ATG13 Peptide - N-terminal region

Gene Names
ATG13; KIAA0652; PARATARG8
Reactivity
Human
Applications
Western Blot
Synonyms
ATG13; ATG13 Peptide - N-terminal region; ATG13 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDW
Sequence Length
517
Applicable Applications for ATG13 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ATG13 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ATG13 Antibody, made

Target Description: ATG13 is an autophagy factor required for autophagosome formation. ATG13 is a target of the TOR kinase signaling pathway that regulates autophagy through the control of the phosphorylation status of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex.
Product Categories/Family for ATG13 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
autophagy-related protein 13 isoform c
NCBI Official Synonym Full Names
autophagy related 13
NCBI Official Symbol
ATG13
NCBI Official Synonym Symbols
KIAA0652; PARATARG8
NCBI Protein Information
autophagy-related protein 13
UniProt Protein Name
Autophagy-related protein 13
Protein Family
UniProt Gene Name
ATG13
UniProt Synonym Gene Names
KIAA0652
UniProt Entry Name
ATG13_HUMAN

NCBI Description

The protein encoded by this gene is an autophagy factor and a target of the TOR kinase signaling pathway. The encoded protein is essential for autophagosome formation and mitophagy. [provided by RefSeq, Oct 2016]

Uniprot Description

ATG13: an autophagy factor required for autophagosome formation. Target of the TOR kinase signaling pathway that regulates autophagy through the control of the phosphorylation status of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex. Under starvation conditions, is localized to puncate structures primarily representing the isolation membrane; the isolation membrane sequesters a portion of the cytoplasm resulting in autophagosome formation. Phosphorylated by ULK1 and ULK2. Phosphorylation status depends on nutrient-rich conditions; dephosphorylated during starvation or following treatment with rapamycin. Part of a complex consisting of ATG13, ULK1 and RB1CC1. Interacts with ATG101. Interacts with ULK1 and -2 via C-terminus. Three isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle; Autophagy

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: mitochondrion; cytosol

Molecular Function: protein binding; protein kinase binding

Biological Process: autophagic vacuole formation

Research Articles on ATG13

Similar Products

Product Notes

The ATG13 atg13 (Catalog #AAA3241300) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ATG13 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATG13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATG13 atg13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: METDLNSQDR KDLDKFIKFF ALKTVQVIVQ ARLGEKICTR SSSSPTGSDW. It is sometimes possible for the material contained within the vial of "ATG13, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.