Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

S100A10 blocking peptide

S100A10 Peptide - middle region

Gene Names
S100A10; 42C; P11; p10; GP11; ANX2L; CAL1L; CLP11; Ca[1]; ANX2LG
Reactivity
Human
Applications
Western Blot
Synonyms
S100A10; S100A10 Peptide - middle region; S100A10 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
DPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Sequence Length
97
Applicable Applications for S100A10 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for S100A10 blocking peptide
This is a synthetic peptide designed for use in combination with anti-S100A10 Antibody, made

Target Description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis.
Product Categories/Family for S100A10 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
protein S100-A10
NCBI Official Synonym Full Names
S100 calcium binding protein A10
NCBI Official Symbol
S100A10
NCBI Official Synonym Symbols
42C; P11; p10; GP11; ANX2L; CAL1L; CLP11; Ca[1]; ANX2LG
NCBI Protein Information
protein S100-A10
UniProt Protein Name
Protein S100-A10
Protein Family
UniProt Gene Name
S100A10
UniProt Synonym Gene Names
ANX2LG; CAL1L; CLP11
UniProt Entry Name
S10AA_HUMAN

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis. [provided by RefSeq, Jul 2008]

Uniprot Description

S100A10: Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine- specific kinase. Heterotetramer containing 2 light chains of S100A10/p11 and 2 heavy chains of ANXA2/p36. Interacts with SCN10A. Belongs to the S-100 family.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: extrinsic to plasma membrane; lipid raft

Molecular Function: protein binding; protein homodimerization activity; calcium ion binding; lipid binding

Biological Process: positive regulation of focal adhesion formation; positive regulation of stress fiber formation; protein heterotetramerization; positive regulation of binding; lipid raft formation; membrane budding

Research Articles on S100A10

Similar Products

Product Notes

The S100A10 s100a10 (Catalog #AAA3241034) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The S100A10 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's S100A10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the S100A10 s100a10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DPLAVDKIMK DLDQCRDGKV GFQSFFSLIA GLTIACNDYF VVHMKQKGKK. It is sometimes possible for the material contained within the vial of "S100A10, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.