Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GHSR blocking peptide

GHSR Peptide - C-terminal region

Gene Names
GHSR; GHDP
Reactivity
Human
Applications
Western Blot
Synonyms
GHSR; GHSR Peptide - C-terminal region; GHSR blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
RKLWRRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLF
Sequence Length
366
Applicable Applications for GHSR blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for GHSR blocking peptide
This is a synthetic peptide designed for use in combination with anti-GHSR Antibody, made

Target Description: This gene encodes a member of the G-protein coupled receptor family. The encoded protein may play a role in energy homeostasis and regulation of body weight. Two identified transcript variants are expressed in several tissues and are evolutionary conserved in fish and swine. One transcript, 1a, excises an intron and encodes the functional protein; this protein is the receptor for the Ghrelin ligand and defines a neuroendocrine pathway for growth hormone release. The second transcript (1b) retains the intron and does not function as a receptor for Ghrelin; however, it may function to attenuate activity of isoform 1a. Mutations in this gene are associated with autosomal idiopathic short stature.
Product Categories/Family for GHSR blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
growth hormone secretagogue receptor type 1 isoform 1a
NCBI Official Synonym Full Names
growth hormone secretagogue receptor
NCBI Official Symbol
GHSR
NCBI Official Synonym Symbols
GHDP
NCBI Protein Information
growth hormone secretagogue receptor type 1
UniProt Protein Name
Growth hormone secretagogue receptor type 1
UniProt Gene Name
GHSR
UniProt Synonym Gene Names
GHS-R; GHRP
UniProt Entry Name
GHSR_HUMAN

NCBI Description

This gene encodes a member of the G-protein coupled receptor family. The encoded protein may play a role in energy homeostasis and regulation of body weight. Two identified transcript variants are expressed in several tissues and are evolutionary conserved in fish and swine. One transcript, 1a, excises an intron and encodes the functional protein; this protein is the receptor for the Ghrelin ligand and defines a neuroendocrine pathway for growth hormone release. The second transcript (1b) retains the intron and does not function as a receptor for Ghrelin; however, it may function to attenuate activity of isoform 1a. Mutations in this gene are associated with autosomal idiopathic short stature.[provided by RefSeq, Apr 2010]

Uniprot Description

GHSR: Receptor for ghrelin, coupled to G-alpha-11 proteins. Stimulates growth hormone secretion. Binds also other growth hormone releasing peptides (GHRP) (e.g. Met-enkephalin and GHRP-6) as well as non-peptide, low molecular weight secretagogues (e.g. L-692,429, MK-0677, adenosine). Defects in GHSR may be a cause of idiopathic short stature autosomal (ISSA). Short stature is defined by a subnormal rate of growth. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1

Chromosomal Location of Human Ortholog: 3q26.31

Cellular Component: neuron projection; cell surface; plasma membrane; integral to membrane; lipid raft

Molecular Function: G-protein coupled receptor activity; growth hormone secretagogue receptor activity; peptide hormone binding; growth hormone-releasing hormone receptor activity

Biological Process: response to food; positive regulation of insulin-like growth factor receptor signaling pathway; hormone-mediated signaling; response to hormone stimulus; negative regulation of interleukin-6 biosynthetic process; adult feeding behavior; positive regulation of multicellular organism growth; decidualization; negative regulation of interleukin-1 beta production; negative regulation of insulin secretion; growth hormone secretion; G-protein coupled receptor protein signaling pathway; positive regulation of fatty acid metabolic process; regulation of synaptogenesis; cellular response to insulin stimulus; negative regulation of inflammatory response; actin polymerization and/or depolymerization; positive regulation of appetite; regulation of hindgut contraction; negative regulation of tumor necrosis factor biosynthetic process

Disease: Short Stature, Idiopathic, Autosomal

Research Articles on GHSR

Similar Products

Product Notes

The GHSR ghsr (Catalog #AAA3241004) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The GHSR Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GHSR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GHSR ghsr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RKLWRRRRGD AVVGASLRDQ NHKQTVKMLA VVVFAFILCW LPFHVGRYLF. It is sometimes possible for the material contained within the vial of "GHSR, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.