Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ABI1 blocking peptide

ABI1 Peptide - N-terminal region

Gene Names
ABI1; E3B1; ABI-1; ABLBP4; NAP1BP; SSH3BP; SSH3BP1
Reactivity
Human
Applications
Western Blot
Synonyms
ABI1; ABI1 Peptide - N-terminal region; ABI1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEET
Sequence Length
508
Applicable Applications for ABI1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ABI1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ABI1 Antibody, made

Target Description: This gene encodes a member of the Abelson-interactor family of adaptor proteins. These proteins facilitate signal transduction as components of several multiprotein complexes, and regulate actin polymerization and cytoskeletal remodeling through interactions with Abelson tyrosine kinases. The encoded protein plays a role in macropinocytosis as a component of the WAVE2 complex, and also forms a complex with EPS8 and SOS1 that mediates signal transduction from Ras to Rac. This gene may play a role in the progression of several malignancies including melanoma, colon cancer and breast cancer, and a t(10;11) chromosomal translocation involving this gene and the MLL gene has been associated with acute myeloid leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 14.
Product Categories/Family for ABI1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
abl interactor 1 isoform a
NCBI Official Synonym Full Names
abl interactor 1
NCBI Official Symbol
ABI1
NCBI Official Synonym Symbols
E3B1; ABI-1; ABLBP4; NAP1BP; SSH3BP; SSH3BP1
NCBI Protein Information
abl interactor 1
UniProt Protein Name
Abl interactor 1
Protein Family
UniProt Gene Name
ABI1
UniProt Synonym Gene Names
SSH3BP1; Abi-1; AblBP4; Eps8-binding protein; Nap1BP
UniProt Entry Name
ABI1_HUMAN

NCBI Description

This gene encodes a member of the Abelson-interactor family of adaptor proteins. These proteins facilitate signal transduction as components of several multiprotein complexes, and regulate actin polymerization and cytoskeletal remodeling through interactions with Abelson tyrosine kinases. The encoded protein plays a role in macropinocytosis as a component of the WAVE2 complex, and also forms a complex with EPS8 and SOS1 that mediates signal transduction from Ras to Rac. This gene may play a role in the progression of several malignancies including melanoma, colon cancer and breast cancer, and a t(10;11) chromosomal translocation involving this gene and the MLL gene has been associated with acute myeloid leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 14. [provided by RefSeq, Sep 2011]

Uniprot Description

Abi-1: an SH3-containing adapter protein that regulates c-Abl-mediated phosphorylation of Mena. Binds the SH3 domains of epidermal growth factor receptor kinase substrate (EPS8) and of spectrin. May play a role in fusion of macropinocytic vesicles. Associated with congenital acute monocytic leukemia.

Protein type: Adaptor/scaffold; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 10p11.2

Cellular Component: postsynaptic membrane; growth cone; cytoskeleton; endoplasmic reticulum; lamellipodium; postsynaptic density; intracellular; nucleus; cytosol; cell junction; filopodium

Molecular Function: protein binding; cytoskeletal protein binding; protein complex binding; protein tyrosine kinase activator activity

Biological Process: negative regulation of cell proliferation; somitogenesis; peptidyl-tyrosine phosphorylation; actin polymerization and/or depolymerization; innate immune response; cell motility; vascular endothelial growth factor receptor signaling pathway; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on ABI1

Similar Products

Product Notes

The ABI1 abi1 (Catalog #AAA3240958) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ABI1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ABI1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ABI1 abi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAELQMLLEE EIPSGKRALI ESYQNLTRVA DYCENNYIQA TDKRKALEET. It is sometimes possible for the material contained within the vial of "ABI1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.