AMMECR1 blocking peptide

AMMECR1 Peptide - C-terminal region

Cat. Num. AAA3240499

• Gene Names: AMMECR1; MFHIEN; AMMERC1
• Reactivity: Human
• Applications: Western Blot
• Synonyms: AMMECR1; AMMECR1 Peptide - C-terminal region; AMMECR1 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: DHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQH
• Sequence Length: 296

• Applicable Applications for AMMECR1 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for AMMECR1 blocking peptide

This is a synthetic peptide designed for use in combination with anti-AMMECR1 Antibody, made

Target Description: The exact function of this gene is not known, however, submicroscopic deletion of the X chromosome including this gene, COL4A5, and FACL4 genes, result in a contiguous gene deletion syndrome, the AMME complex (Alport syndrome, mental retardation, midface hypoplasia, and elliptocytosis). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for AMMECR1 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 70995235
• NCBI GeneID: 9949
• NCBI Accession #: NP_001020751
• NCBI GenBank Nucleotide #: NM_001025580
• UniProt Accession #: Q9Y4X0
• Molecular Weight: 31kDa
• NCBI Official Full Name: AMME syndrome candidate gene 1 protein isoform 2
• NCBI Official Synonym Full Names: Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1
• NCBI Official Symbol: AMMECR1
• NCBI Official Synonym Symbols: MFHIEN; AMMERC1
• NCBI Protein Information: AMME syndrome candidate gene 1 protein
• UniProt Protein Name: AMME syndrome candidate gene 1 protein
• Protein Family: AMMECR1-like protein
• UniProt Gene Name: AMMECR1
• UniProt Entry Name: AMMR1_HUMAN

NCBI Description

The exact function of this gene is not known, however, submicroscopic deletion of the X chromosome including this gene, COL4A5, and FACL4 genes, result in a contiguous gene deletion syndrome, the AMME complex (Alport syndrome, mental retardation, midface hypoplasia, and elliptocytosis). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]