FCAMR blocking peptide
FCAMR Peptide - C-terminal region
Gene Names
FCAMR; CD351; FCA/MR; FKSG87
Reactivity
Human
Applications
Western Blot
Synonyms
FCAMR; FCAMR Peptide - C-terminal region; FCAMR blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
ATLSQTPAVGPWGPPGKESSVKRTFPEDESSSRTLAPVSTMLALFMLMAL
Sequence Length
577
Applicable Applications for FCAMR blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FCAMR blocking peptide
This is a synthetic peptide designed for use in combination with anti-FCAMR Antibody, made
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for FCAMR blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
high affinity immunoglobulin alpha and immunoglobulin mu Fc receptor isoform b
NCBI Official Synonym Full Names
Fc fragment of IgA and IgM receptor
NCBI Official Symbol
FCAMR
NCBI Official Synonym Symbols
CD351; FCA/MR; FKSG87
NCBI Protein Information
high affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
UniProt Protein Name
High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
UniProt Gene Name
FCAMR
UniProt Synonym Gene Names
FKSG87
UniProt Entry Name
FCAMR_HUMAN
Uniprot Description
FCAMR: Functions as a receptor for the Fc fragment of IgA and IgM. Binds IgA and IgM with high affinity and mediates their endocytosis. May function in the immune response to microbes mediated by IgA and IgM. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 1q32.1
Cellular Component: plasma membrane; integral to membrane
Biological Process: immune system process
Research Articles on FCAMR
Similar Products
Product Notes
The FCAMR fcamr (Catalog #AAA3239782) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FCAMR Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FCAMR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FCAMR fcamr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ATLSQTPAVG PWGPPGKESS VKRTFPEDES SSRTLAPVST MLALFMLMAL. It is sometimes possible for the material contained within the vial of "FCAMR, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
