Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

BSG blocking peptide

BSG Peptide - middle region

Gene Names
BSG; OK; 5F7; TCSF; CD147; EMPRIN; EMMPRIN; SLC7A11
Reactivity
Human
Applications
Western Blot
Synonyms
BSG; BSG Peptide - middle region; BSG blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
KILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEY
Sequence Length
385
Applicable Applications for BSG blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for BSG blocking peptide
This is a synthetic peptide designed for use in combination with anti-BSG Antibody, made

Target Description: The protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for BSG blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
682
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
basigin isoform 1
NCBI Official Synonym Full Names
basigin (Ok blood group)
NCBI Official Symbol
BSG
NCBI Official Synonym Symbols
OK; 5F7; TCSF; CD147; EMPRIN; EMMPRIN; SLC7A11
NCBI Protein Information
basigin
UniProt Protein Name
Basigin
Protein Family
UniProt Gene Name
BSG
UniProt Synonym Gene Names
EMMPRIN; TCSF
UniProt Entry Name
BASI_HUMAN

NCBI Description

The protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

BSG: Plays pivotal roles in spermatogenesis, embryo implantation, neural network formation and tumor progression. Stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). May target monocarboxylate transporters SLC16A1, SLC16A3 and SLC16A8 to plasma membranes of retinal pigment epithelium and neural retina. Seems to be a receptor for oligomannosidic glycans. In vitro, promotes outgrowth of astrocytic processes. Enriched on the surface of tumor cells. Up-regulated in gliomas. Its expression levels correlate with malignant potential of the tumor. Forms homooligomers in a cis-dependent manner on the plasma membrane. Forms a complex with MMP1 at the tumor cell surface. Interacts with SLC16A1 and SLC1A3; probably a BSG dimer is associated with a monocarboxylate transporter dimer. Interacts with ATP1B2, MAG and L1CAM. Interacts with AJAP1. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: Golgi membrane; focal adhesion; membrane; mitochondrion; integral to plasma membrane; melanosome; plasma membrane; sarcolemma; acrosomal membrane; lipid raft

Molecular Function: mannose binding; protein binding

Biological Process: response to peptide hormone stimulus; extracellular matrix organization and biogenesis; response to cAMP; decidualization; odontogenesis of dentine-containing teeth; response to mercury ion; cellular metabolic process; extracellular matrix disassembly; cell surface receptor linked signal transduction; blood coagulation; pyruvate metabolic process; leukocyte migration; embryo implantation

Disease: Blood Group--ok

Research Articles on BSG

Similar Products

Product Notes

The BSG bsg (Catalog #AAA3239425) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The BSG Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BSG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BSG bsg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KILLTCSLND SATEVTGHRW LKGGVVLKED ALPGQKTEFK VDSDDQWGEY. It is sometimes possible for the material contained within the vial of "BSG, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.