SYT2 blocking peptide

SYT2 Peptide - C-terminal region

Cat. Num. AAA3239294

• Gene Names: SYT2; CMS7; MYSPC; SytII
• Reactivity: Human
• Applications: Western Blot
• Synonyms: SYT2; SYT2 Peptide - C-terminal region; SYT2 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: AIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK
• Sequence Length: 419

• Applicable Applications for SYT2 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for SYT2 blocking peptide

This is a synthetic peptide designed for use in combination with anti-SYT2 Antibody, made

Target Description: Synaptotagmins, like SYT2, are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (Hilbush and Morgan, 1994 [PubMed 8058779]).

Product Categories/Family for SYT2 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 31543670
• NCBI GeneID: 127833
• NCBI Accession #: NP_796376
• NCBI GenBank Nucleotide #: NM_177402
• UniProt Accession #: Q8N9I0
• Molecular Weight: 47kDa
• NCBI Official Full Name: synaptotagmin-2
• NCBI Official Synonym Full Names: synaptotagmin 2
• NCBI Official Symbol: SYT2
• NCBI Official Synonym Symbols: CMS7; MYSPC; SytII
• NCBI Protein Information: synaptotagmin-2
• UniProt Protein Name: Synaptotagmin-2
• Protein Family: Synaptotagmin
• UniProt Gene Name: SYT2
• UniProt Synonym Gene Names: SytII
• UniProt Entry Name: SYT2_HUMAN

NCBI Description

This gene encodes a synaptic vesicle membrane protein. The encoded protein is thought to function as a calcium sensor in vesicular trafficking and exocytosis. Mutations in this gene are associated with myasthenic syndrome, presynaptic, congenital, with or without motor neuropathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]

Uniprot Description

SYT2: May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. Belongs to the synaptotagmin family.

Protein type: Lipid-binding; Membrane protein, integral; Calcium-binding; Vesicle

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: synaptic vesicle membrane; intracellular membrane-bound organelle; plasma membrane; integral to membrane; cell junction

Molecular Function: protein binding; calcium-dependent phospholipid binding; transporter activity; calcium ion binding

Biological Process: transport; pathogenesis

Disease: Myasthenic Syndrome, Presynaptic, Congenital, With Or Without Motor Neuropathy