Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SERPINE1 blocking peptide

SERPINE1 Peptide - middle region

Gene Names
SERPINE1; PAI; PAI1; PAI-1; PLANH1
Reactivity
Human
Applications
Western Blot
Synonyms
SERPINE1; SERPINE1 Peptide - middle region; SERPINE1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
PFPDSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELP
Sequence Length
402
Applicable Applications for SERPINE1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SERPINE1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SERPINE1 Antibody, made

Target Description: SERPINE1 acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.
Product Categories/Family for SERPINE1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
plasminogen activator inhibitor 1
NCBI Official Synonym Full Names
serpin family E member 1
NCBI Official Symbol
SERPINE1
NCBI Official Synonym Symbols
PAI; PAI1; PAI-1; PLANH1
NCBI Protein Information
plasminogen activator inhibitor 1
UniProt Protein Name
Plasminogen activator inhibitor 1
UniProt Gene Name
SERPINE1
UniProt Synonym Gene Names
PAI1; PLANH1; PAI; PAI-1
UniProt Entry Name
PAI1_HUMAN

NCBI Description

This gene encodes a member of the serine proteinase inhibitor (serpin) superfamily. This member is the principal inhibitor of tissue plasminogen activator (tPA) and urokinase (uPA), and hence is an inhibitor of fibrinolysis. Defects in this gene are the cause of plasminogen activator inhibitor-1 deficiency (PAI-1 deficiency), and high concentrations of the gene product are associated with thrombophilia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]

Uniprot Description

SERPINE1: a secreted protein that acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis. Belongs to the serpin family. Interacts with VTN. Binds LRP1B; binding is followed by internalization and degradation. Plasma levels of PAI-1 and VCAM-1 together may be useful in predicting post-operative recurrence in patients with colorectal cancer.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: extracellular matrix; extracellular space; plasma membrane; extracellular region

Molecular Function: serine-type endopeptidase inhibitor activity; protein binding; protease binding; receptor binding

Biological Process: circadian rhythm; extracellular matrix organization and biogenesis; positive regulation of blood coagulation; negative regulation of smooth muscle cell migration; defense response to Gram-negative bacterium; positive regulation of receptor-mediated endocytosis; positive regulation of interleukin-8 production; platelet degranulation; negative regulation of fibrinolysis; transforming growth factor beta receptor signaling pathway; angiogenesis; regulation of receptor activity; chronological cell aging; negative regulation of cell adhesion mediated by integrin; negative regulation of cell migration; platelet activation; transcription initiation from RNA polymerase II promoter; transcription, DNA-dependent; negative regulation of blood coagulation; regulation of cell proliferation; positive regulation of angiogenesis; fibrinolysis; positive regulation of transcription from RNA polymerase II promoter; gene expression; blood coagulation; positive regulation of inflammatory response

Disease: Plasminogen Activator Inhibitor-1 Deficiency

Research Articles on SERPINE1

Similar Products

Product Notes

The SERPINE1 serpine1 (Catalog #AAA3239181) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SERPINE1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SERPINE1 serpine1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PFPDSSTHRR LFHKSDGSTV SVPMMAQTNK FNYTEFTTPD GHYYDILELP. It is sometimes possible for the material contained within the vial of "SERPINE1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.