Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CD28 blocking peptide

CD28 Peptide - C-terminal region

Gene Names
CD28; Tp44
Reactivity
Human
Applications
Western Blot
Synonyms
CD28; CD28 Peptide - C-terminal region; CD28 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
TVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Sequence Length
220
Applicable Applications for CD28 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CD28 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CD28 Antibody, made

Target Description: CD28 is involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival.
Product Categories/Family for CD28 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
940
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
T-cell-specific surface glycoprotein CD28 isoform 1
NCBI Official Synonym Full Names
CD28 molecule
NCBI Official Symbol
CD28
NCBI Official Synonym Symbols
Tp44
NCBI Protein Information
T-cell-specific surface glycoprotein CD28
UniProt Protein Name
T-cell-specific surface glycoprotein CD28
UniProt Gene Name
CD28
UniProt Entry Name
CD28_HUMAN

NCBI Description

The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2011]

Uniprot Description

CD28: a type I plasma membrane protein Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Binds to B7-1 and -2. Expressed in T cells and plasma cells, but not in less mature B cells. Six splice-variant isoforms have been described.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q33

Cellular Component: integral to plasma membrane; plasma membrane; immunological synapse; cytosol; external side of plasma membrane

Molecular Function: identical protein binding; protein binding; SH3/SH2 adaptor activity; protease binding; coreceptor activity

Biological Process: positive regulation of isotype switching to IgG isotypes; positive regulation of translation; nerve growth factor receptor signaling pathway; viral reproduction; positive regulation of interleukin-2 biosynthetic process; cytokine biosynthetic process; T cell receptor signaling pathway; positive regulation of inflammatory response to antigenic stimulus; cell surface receptor linked signal transduction; positive regulation of T cell proliferation; regulatory T cell differentiation; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; positive regulation of viral genome replication; positive regulation of mitosis; negative thymic T cell selection; regulation of defense response to virus by virus; humoral immune response; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of protein kinase B signaling cascade; T cell costimulation; innate immune response; positive regulation of alpha-beta T cell proliferation; positive regulation of transcription from RNA polymerase II promoter

Research Articles on CD28

Similar Products

Product Notes

The CD28 cd28 (Catalog #AAA3239118) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CD28 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD28 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD28 cd28 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TVAFIIFWVR SKRSRLLHSD YMNMTPRRPG PTRKHYQPYA PPRDFAAYRS. It is sometimes possible for the material contained within the vial of "CD28, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.