Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TRMT9B blocking peptide

TRMT9B Peptide - N-terminal region

Gene Names
TRMT9B; TRM9L; hTRM9L; C8orf79; KIAA1456
Reactivity
Human
Synonyms
TRMT9B; TRMT9B Peptide - N-terminal region; TRMT9B blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: CGTGKYLKVNSQVHTVGCDYCGPLVEIARNRGCEAMVCDNLNLPFRDEGF
Sequence Length
454
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Product Categories/Family for TRMT9B blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Synonym Full Names
tRNA methyltransferase 9B (putative)
NCBI Official Symbol
TRMT9B
NCBI Official Synonym Symbols
TRM9L; hTRM9L; C8orf79; KIAA1456
NCBI Protein Information
probable tRNA methyltransferase 9B
UniProt Protein Name
Probable tRNA methyltransferase 9-like protein
UniProt Gene Name
KIAA1456
UniProt Synonym Gene Names
C8orf79; TRM9L

Uniprot Description

KIAA1456: Belongs to the methyltransferase superfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.1.1.-; Methyltransferase

Chromosomal Location of Human Ortholog: 8p22

Cellular Component: cytoplasm; nucleus

Molecular Function: ferrous iron binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors; tRNA (uracil) methyltransferase activity; tRNA binding; tRNA methyltransferase activity

Biological Process: tRNA methylation; tRNA modification; tRNA wobble uridine modification

Research Articles on TRMT9B

Similar Products

Product Notes

The TRMT9B kiaa1456 (Catalog #AAA3238323) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TRMT9B Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: CGTGKYLKVN SQVHTVGCDY CGPLVEIARN RGCEAMVCDN LNLPFRDEGF. It is sometimes possible for the material contained within the vial of "TRMT9B, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.