DBNDD2 blocking peptide
DBNDD2 Peptide - middle region
Gene Names
DBNDD2; CK1BP; HSMNP1; C20orf35
Reactivity
Human
Applications
Western Blot
Synonyms
DBNDD2; DBNDD2 Peptide - middle region; DBNDD2 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGS
Sequence Length
161
Applicable Applications for DBNDD2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DBNDD2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-DBNDD2 Antibody, made
Target Description: DBNDD2 may modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro). .
Target Description: DBNDD2 may modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro). .
Product Categories/Family for DBNDD2 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
dysbindin domain-containing protein 2 isoform a
NCBI Official Synonym Full Names
dysbindin domain containing 2
NCBI Official Symbol
DBNDD2
NCBI Official Synonym Symbols
CK1BP; HSMNP1; C20orf35
NCBI Protein Information
dysbindin domain-containing protein 2
UniProt Protein Name
Dysbindin domain-containing protein 2
Protein Family
UniProt Gene Name
DBNDD2
UniProt Synonym Gene Names
C20orf35; CK1BP
UniProt Entry Name
DBND2_HUMAN
Uniprot Description
DBNDD2: May modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro). Belongs to the dysbindin family. 3 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 20q13.12
Cellular Component: cytoplasm
Molecular Function: protein binding
Biological Process: negative regulation of protein kinase activity
Research Articles on DBNDD2
Similar Products
Product Notes
The DBNDD2 dbndd2 (Catalog #AAA3237627) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DBNDD2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DBNDD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DBNDD2 dbndd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DPNPRAALER QQLRLRERQK FFEDILQPET EFVFPLSHLH LESQRPPIGS. It is sometimes possible for the material contained within the vial of "DBNDD2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
