Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

IL1F5 blocking peptide

IL1F5 Peptide - middle region

Gene Names
IL36RN; FIL1; FIL1D; IL1F5; IL1L1; PSORP; IL1HY1; IL1RP3; IL36RA; IL-36Ra; PSORS14; FIL1(DELTA)
Reactivity
Human
Applications
Western Blot
Synonyms
IL1F5; IL1F5 Peptide - middle region; IL1F5 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Sequence Length
155
Applicable Applications for IL1F5 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for IL1F5 blocking peptide
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported.
Product Categories/Family for IL1F5 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
interleukin-36 receptor antagonist protein
NCBI Official Synonym Full Names
interleukin 36 receptor antagonist
NCBI Official Symbol
IL36RN
NCBI Official Synonym Symbols
FIL1; FIL1D; IL1F5; IL1L1; PSORP; IL1HY1; IL1RP3; IL36RA; IL-36Ra; PSORS14; FIL1(DELTA)
NCBI Protein Information
interleukin-36 receptor antagonist protein
UniProt Protein Name
Interleukin-36 receptor antagonist protein
UniProt Gene Name
IL36RN
UniProt Synonym Gene Names
FIL1D; IL1F5; IL1HY1; IL1L1; IL1RP3; IL-1RP3; IL-1HY1; IL-1 delta; IL-1F5; IL-1ra homolog 1; IL-1L1
UniProt Entry Name
I36RA_HUMAN

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

IL1F5: Is a highly and a specific antagonist of the IL-1 receptor-related protein 2-mediated response to interleukin 1 family member 9 (IL1F9). Could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL- 1R1), that is present in epithelial barriers and takes part in local inflammatory response. Defects in IL36RN are the cause of psoriasis generalized pustular (PSORP). PSORP is a life-threatening disease defined by repeated flares of sudden onset consisting of diffuse erythematous skin eruption characterized by rapid coverage with pustules, high-grade fever, asthenia, marked leukocytosis, and elevated serum levels of C-reactive protein. Belongs to the IL-1 family.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 2q14

Cellular Component: extracellular space

Molecular Function: cytokine activity; interleukin-1 receptor binding; protein binding

Biological Process: antifungal humoral response; negative regulation of cytokine and chemokine mediated signaling pathway; negative regulation of interleukin-17 production

Disease: Psoriasis 14, Pustular

Research Articles on IL1F5

Similar Products

Product Notes

The IL1F5 il36rn (Catalog #AAA3237266) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The IL1F5 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL1F5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL1F5 il36rn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LTSSFESAAY PGWFLCTVPE ADQPVRLTQL PENGGWNAPI TDFYFQQCD. It is sometimes possible for the material contained within the vial of "IL1F5, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.