Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FDXR blocking peptide

FDXR Peptide - N-terminal region

Gene Names
FDXR; ADXR; ANOA
Reactivity
Human
Applications
Western Blot
Synonyms
FDXR; FDXR Peptide - N-terminal region; FDXR blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
DHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGN
Sequence Length
491
Applicable Applications for FDXR blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FDXR blocking peptide
This is a synthetic peptide designed for use in combination with anti-FDXR Antibody, made

Target Description: This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH. Multiple alternatively spliced transcript variants of this gene have been described although the full-length nature of only two that encode different isoforms have been determined.
Product Categories/Family for FDXR blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
NADPH:adrenodoxin oxidoreductase, mitochondrial isoform 1
NCBI Official Synonym Full Names
ferredoxin reductase
NCBI Official Symbol
FDXR
NCBI Official Synonym Symbols
ADXR; ANOA
NCBI Protein Information
NADPH:adrenodoxin oxidoreductase, mitochondrial
UniProt Protein Name
NADPH:adrenodoxin oxidoreductase, mitochondrial
UniProt Gene Name
FDXR
UniProt Synonym Gene Names
ADXR; AR; Adrenodoxin reductase; Ferredoxin reductase
UniProt Entry Name
ADRO_HUMAN

NCBI Description

This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Apr 2012]

Uniprot Description

FDXR: Serves as the first electron transfer protein in all the mitochondrial P450 systems. Including cholesterol side chain cleavage in all steroidogenic tissues, steroid 11-beta hydroxylation in the adrenal cortex, 25-OH-vitamin D3-24 hydroxylation in the kidney, and sterol C-27 hydroxylation in the liver. Belongs to the ferredoxin--NADP reductase type 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Oxidoreductase; Mitochondrial; EC 1.18.1.6

Chromosomal Location of Human Ortholog: 17q25.1

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: protein binding; ferredoxin-NADP+ reductase activity; NADPH-adrenodoxin reductase activity

Biological Process: steroid metabolic process; cholesterol metabolic process; ubiquinone biosynthetic process; generation of precursor metabolites and energy; xenobiotic metabolic process; C21-steroid hormone biosynthetic process; steroid biosynthetic process; sterol metabolic process

Research Articles on FDXR

Similar Products

Product Notes

The FDXR fdxr (Catalog #AAA3236760) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FDXR Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FDXR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FDXR fdxr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DHRALEIPGE ELPGVCSARA FVGWYNGLPE NQELEPDLSC DTAVILGQGN. It is sometimes possible for the material contained within the vial of "FDXR, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.