Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

HSD3B7 blocking peptide

HSD3B7 Peptide - middle region

Gene Names
HSD3B7; CBAS1; PFIC4; SDR11E3
Reactivity
Human
Applications
Western Blot
Synonyms
HSD3B7; HSD3B7 Peptide - middle region; HSD3B7 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHR
Sequence Length
369
Applicable Applications for HSD3B7 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for HSD3B7 blocking peptide
This is a synthetic peptide designed for use in combination with anti-HSD3B7 Antibody, made

Target Description: This gene encodes an enzyme which is involved in the initial stages of the synthesis of bile acids from cholesterol and a member of the short-chain dehydrogenase/reductase superfamily. The encoded protein is a membrane-associated endoplasmic reticulum protein which is active against 7-alpha hydrosylated sterol substrates. Mutations in this gene are associated with a congenital bile acid synthesis defect which leads to neonatal cholestasis, a form of progressive liver disease. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for HSD3B7 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
3 beta-hydroxysteroid dehydrogenase type 7 isoform a
NCBI Official Synonym Full Names
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7
NCBI Official Symbol
HSD3B7
NCBI Official Synonym Symbols
CBAS1; PFIC4; SDR11E3
NCBI Protein Information
3 beta-hydroxysteroid dehydrogenase type 7
UniProt Protein Name
3 beta-hydroxysteroid dehydrogenase type 7
UniProt Gene Name
HSD3B7
UniProt Synonym Gene Names
3-beta-HSD VII; C(27) 3-beta-HSD
UniProt Entry Name
3BHS7_HUMAN

NCBI Description

This gene encodes an enzyme which is involved in the initial stages of the synthesis of bile acids from cholesterol and a member of the short-chain dehydrogenase/reductase superfamily. The encoded protein is a membrane-associated endoplasmic reticulum protein which is active against 7-alpha hydrosylated sterol substrates. Mutations in this gene are associated with a congenital bile acid synthesis defect which leads to neonatal cholestasis, a form of progressive liver disease. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]

Uniprot Description

HSD3B7: The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. HSD VII is active against four 7-alpha-hydroxylated sterols. Does not metabolize several different C(19/21) steroids as substrates. Involved in bile acid synthesis. Defects in HSD3B7 are the cause of congenital bile acid synthesis defect type 1 (CBAS1); also known as neonatal progressive intrahepatic cholestasis. CBAS1 is due to a primary defect in bile synthesis leading to progressive liver disease. Clinical features include neonatal jaundice, severe intrahepatic cholestasis and cirrhosis. Belongs to the 3-beta-HSD family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.1.1.181; Membrane protein, multi-pass; Lipid Metabolism - primary bile acid biosynthesis; Oxidoreductase; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: cholest-5-ene-3-beta,7-alpha-diol 3-beta-dehydrogenase activity; 3-beta-hydroxy-delta5-steroid dehydrogenase activity

Biological Process: bile acid biosynthetic process; bile acid metabolic process

Disease: Bile Acid Synthesis Defect, Congenital, 1

Research Articles on HSD3B7

Similar Products

Product Notes

The HSD3B7 hsd3b7 (Catalog #AAA3234663) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The HSD3B7 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSD3B7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HSD3B7 hsd3b7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QGTRNVIEAC VQTGTRFLVY TSSMEVVGPN TKGHPFYRGN EDTPYEAVHR. It is sometimes possible for the material contained within the vial of "HSD3B7, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.