SLC5A5 blocking peptide
SLC5A5 Peptide - N-terminal region
Gene Names
SLC5A5; NIS; TDH1
Reactivity
Human
Applications
Western Blot
Synonyms
SLC5A5; SLC5A5 Peptide - N-terminal region; SLC5A5 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR
Sequence Length
643
Applicable Applications for SLC5A5 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SLC5A5 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SLC5A5 Antibody, made
Target Description: The sodium-iodide symporter (NIS, or SLC5A5) is a key plasma membrane protein that mediates active I- uptake in thyroid, lactating breast, and other tissues with an electrogenic stoichiometry of 2 Na+ per I-. In thyroid, NIS-mediated I- uptake is the first step in the biosynthesis of iodine-containing thyroid hormones.
Target Description: The sodium-iodide symporter (NIS, or SLC5A5) is a key plasma membrane protein that mediates active I- uptake in thyroid, lactating breast, and other tissues with an electrogenic stoichiometry of 2 Na+ per I-. In thyroid, NIS-mediated I- uptake is the first step in the biosynthesis of iodine-containing thyroid hormones.
Product Categories/Family for SLC5A5 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
sodium/iodide cotransporter
NCBI Official Synonym Full Names
solute carrier family 5 member 5
NCBI Official Symbol
SLC5A5
NCBI Official Synonym Symbols
NIS; TDH1
NCBI Protein Information
sodium/iodide cotransporter
UniProt Protein Name
Sodium/iodide cotransporter
Protein Family
UniProt Gene Name
SLC5A5
UniProt Synonym Gene Names
NIS; Na(+)/I(-) cotransporter; Na(+)/I(-) symporter
NCBI Description
This gene encodes a member of the sodium glucose cotransporter family. The encoded protein is responsible for the uptake of iodine in tissues such as the thyroid and lactating breast tissue. The iodine taken up by the thyroid is incorporated into the metabolic regulators triiodothyronine (T3) and tetraiodothyronine (T4). Mutations in this gene are associated with thyroid dyshormonogenesis 1.[provided by RefSeq, Sep 2009]
Uniprot Description
Mediates iodide uptake in the thyroid gland.
Research Articles on SLC5A5
Similar Products
Product Notes
The SLC5A5 slc5a5 (Catalog #AAA3231979) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SLC5A5 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC5A5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC5A5 slc5a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TAVGGMKAVV WTDVFQVVVM LSGFWVVLAR GVMLVGGPRQ VLTLAQNHSR. It is sometimes possible for the material contained within the vial of "SLC5A5, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
