SLC43A2 blocking peptide
SLC43A2 Peptide - middle region
Gene Names
SLC43A2; LAT4
Reactivity
Human
Applications
Western Blot
Synonyms
SLC43A2; SLC43A2 Peptide - middle region; SLC43A2 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ECEDASEEPEEKDANQGEKKKKKRDRQIQKITNAMRAFAFTNLLLVGFGV
Sequence Length
569
Applicable Applications for SLC43A2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SLC43A2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SLC43A2 Antibody, made
Target Description: System L amino acid transporters, such as SLC43A2, mediate sodium-independent transport of bulky neutral amino acids across cell membranes.
Target Description: System L amino acid transporters, such as SLC43A2, mediate sodium-independent transport of bulky neutral amino acids across cell membranes.
Product Categories/Family for SLC43A2 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
large neutral amino acids transporter small subunit 4 isoform 1
NCBI Official Synonym Full Names
solute carrier family 43 member 2
NCBI Official Symbol
SLC43A2
NCBI Official Synonym Symbols
LAT4
NCBI Protein Information
large neutral amino acids transporter small subunit 4
UniProt Protein Name
Large neutral amino acids transporter small subunit 4
Protein Family
UniProt Gene Name
SLC43A2
UniProt Synonym Gene Names
LAT4; PP7664
UniProt Entry Name
LAT4_HUMAN
NCBI Description
This gene encodes a member of the L-amino acid transporter-3 or SLC43 family of transporters. The encoded protein mediates sodium-, chloride-, and pH-independent transport of L-isomers of neutral amino acids, including leucine, phenylalanine, valine and methionine. This protein may contribute to the transfer of amino acids across the placental membrane to the fetus. [provided by RefSeq, Mar 2016]
Research Articles on SLC43A2
Similar Products
Product Notes
The SLC43A2 slc43a2 (Catalog #AAA3230316) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SLC43A2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC43A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC43A2 slc43a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ECEDASEEPE EKDANQGEKK KKKRDRQIQK ITNAMRAFAF TNLLLVGFGV. It is sometimes possible for the material contained within the vial of "SLC43A2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
