Klf11 blocking peptide
Klf11 Peptide - middle region
Gene Names
Klf11; Tieg2; Tieg3; Tieg2b; 9830142A17; D12Ertd427e
Reactivity
Mouse
Applications
Western Blot
Synonyms
Klf11; Klf11 Peptide - middle region; Klf11 blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
PASGSSCRAVMTSVIRHTGESPAPTRFPTGPTQEQRASDSGEGQERLLDH
Sequence Length
502
Applicable Applications for Klf11 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Klf11 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Klf11 Antibody, made
Target Description: Klf11 is a transcription factor. Klf11 activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding sites inhibiting cell growth.Klf11 represses transcription of SMAD7 which enhances TGF-beta signaling. Klf11 also induces apoptosis.
Target Description: Klf11 is a transcription factor. Klf11 activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding sites inhibiting cell growth.Klf11 represses transcription of SMAD7 which enhances TGF-beta signaling. Klf11 also induces apoptosis.
Product Categories/Family for Klf11 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
Krueppel-like factor 11
NCBI Official Synonym Full Names
Kruppel-like factor 11
NCBI Official Symbol
Klf11
NCBI Official Synonym Symbols
Tieg2; Tieg3; Tieg2b; 9830142A17; D12Ertd427e
NCBI Protein Information
Krueppel-like factor 11
UniProt Protein Name
Krueppel-like factor 11
Protein Family
UniProt Gene Name
Klf11
UniProt Synonym Gene Names
Tieg2b; Tieg3; TGFB-inducible early growth response protein 3; TIEG-3
UniProt Entry Name
KLF11_MOUSE
Research Articles on Klf11
Similar Products
Product Notes
The Klf11 klf11 (Catalog #AAA3228619) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Klf11 Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Klf11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Klf11 klf11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PASGSSCRAV MTSVIRHTGE SPAPTRFPTG PTQEQRASDS GEGQERLLDH. It is sometimes possible for the material contained within the vial of "Klf11, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
