Pdx1 blocking peptide

Pdx1 Peptide - N-terminal region

Cat. Num. AAA3225737

• Gene Names: Pdx1; Ipf1; IDX-1; IPF-1; Mody4; STF-1; pdx-1
• Reactivity: Mouse
• Applications: Western Blot
• Synonyms: Pdx1; Pdx1 Peptide - N-terminal region; Pdx1 blocking peptide

• Reactivity: Mouse
• Form/Format: Lyophilized powder
• Sequence: LYMGRQPPPPPPPQFTSSLGSLEQGSPPDISPYEVPPLASDDPAGAHLHH
• Sequence Length: 284

• Applicable Applications for Pdx1 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for Pdx1 blocking peptide

This is a synthetic peptide designed for use in combination with anti-Pdx1 Antibody, made

Target Description: Pdx1 activates insulin and somatostatin gene transcription. It is a key regulator of islet peptide hormone expression but also responsible for the development of the pancreas, most probably by determining maturation and differentiation of common pancreatic precursor cells in the developing gut. It binds the DNA sequence 5'-CC[CT]TAATGGG-3'.

Product Categories/Family for Pdx1 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 6679269
• NCBI GeneID: 18609
• NCBI Accession #: NP_032840
• NCBI GenBank Nucleotide #: NM_008814
• UniProt Accession #: P52946
• Molecular Weight: 31kDa
• NCBI Official Full Name: pancreas/duodenum homeobox protein 1
• NCBI Official Synonym Full Names: pancreatic and duodenal homeobox 1
• NCBI Official Symbol: Pdx1
• NCBI Official Synonym Symbols: Ipf1; IDX-1; IPF-1; Mody4; STF-1; pdx-1
• NCBI Protein Information: pancreas/duodenum homeobox protein 1
• UniProt Protein Name: Pancreas/duodenum homeobox protein 1
• Protein Family: Pyridoxal 5'-phosphate synthase
• UniProt Gene Name: Pdx1
• UniProt Synonym Gene Names: Ipf1; IPF-1; IDX-1; STF-1

Uniprot Description

Activates insulin and somatostatin gene transcription. Key regulator of islet peptide hormone expression but also responsible for the development of the pancreas, most probably by determining maturation and differentiation of common pancreatic precursor cells in the developing gut. As part of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells is involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element. Binds the DNA sequence 5'-CC[CT]TAATGGG-3'.