Western Blot (WB)
(Host: RabbitTarget Name: SPIN2ASample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human SPIN2A Polyclonal Antibody | anti-SPIN2A antibody
SPIN2A Antibody - N-terminal region
Gene Names
SPIN2A; DXF34; SPIN2; TDRD25; dJ323P24.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SPIN2A; Polyclonal Antibody; SPIN2A Antibody - N-terminal region; anti-SPIN2A antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKGTVLDQ
Sequence Length
258
Applicable Applications for anti-SPIN2A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SPIN2A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SPIN2ASample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SPIN2ASample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SPIN2A antibody
This gene encodes one of three members of the DXF34 gene family, located in a 100-kb region of chromosome Xp11.21.
Product Categories/Family for anti-SPIN2A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29 kDa
NCBI Official Full Name
spindlin-2A
NCBI Official Synonym Full Names
spindlin family member 2A
NCBI Official Symbol
SPIN2A
NCBI Official Synonym Symbols
DXF34; SPIN2; TDRD25; dJ323P24.1
NCBI Protein Information
spindlin-2A
UniProt Protein Name
Spindlin-2A
Protein Family
UniProt Gene Name
SPIN2A
UniProt Synonym Gene Names
DXF34; SPIN2; SPIN-2; SPIN-2A
UniProt Entry Name
SPI2A_HUMAN
NCBI Description
This gene encodes one of three members of the DXF34 gene family, located in a 100-kb region of chromosome Xp11.21. [provided by RefSeq, Nov 2009]
Research Articles on SPIN2A
Similar Products
Product Notes
The SPIN2A spin2a (Catalog #AAA3222958) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPIN2A Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPIN2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPIN2A spin2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NMTKKKVSQK KQRGRPSSQP RRNIVGCRIS HGWKEGDEPI TQWKGTVLDQ. It is sometimes possible for the material contained within the vial of "SPIN2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
