Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: LPCAT3Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human LPCAT3 Polyclonal Antibody | anti-LPCAT3 antibody

LPCAT3 Antibody - N-terminal region

Gene Names
LPCAT3; C3F; LPCAT; LPSAT; OACT5; nessy; MBOAT5; LPLAT 5
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
LPCAT3; Polyclonal Antibody; LPCAT3 Antibody - N-terminal region; anti-LPCAT3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TVVALAGVLQSGFQELSLNKLATSLGASEQALRLIISIFLGYPFALFYRH
Sequence Length
487
Applicable Applications for anti-LPCAT3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LPCAT3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LPCAT3Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: LPCAT3Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-LPCAT3 antibody
Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine or PC) (LPCAT activity). Catalyzes also the conversion of lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). Has also weak lysophosphatidylethanolamine acyltransferase activity (LPEAT activity). Favors polyunsaturated fatty acyl-CoAs as acyl donors compared to saturated fatty acyl-CoAs. Seems to be the major enzyme contributing to LPCAT activity in the liver. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle.
Product Categories/Family for anti-LPCAT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56 kDa
NCBI Official Full Name
lysophospholipid acyltransferase 5
NCBI Official Synonym Full Names
lysophosphatidylcholine acyltransferase 3
NCBI Official Symbol
LPCAT3
NCBI Official Synonym Symbols
C3F; LPCAT; LPSAT; OACT5; nessy; MBOAT5; LPLAT 5
NCBI Protein Information
lysophospholipid acyltransferase 5
UniProt Protein Name
Lysophospholipid acyltransferase 5
UniProt Gene Name
LPCAT3
UniProt Synonym Gene Names
MBOAT5; OACT5; LPLAT 5; LPCAT; Lyso-PC acyltransferase; Lyso-PC acyltransferase 3; LPSAT; Lyso-PS acyltransferase; O-acyltransferase domain-containing protein 5
UniProt Entry Name
MBOA5_HUMAN

Uniprot Description

MBOAT5: Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into phosphatidylcholine (1,2-diacyl-sn-glycero-3- phosphocholine or PC) (LPCAT activity). Catalyzes also the conversion of lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero- 3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn- glycero-3-phospho-L-serine or PS) (LPSAT activity). Has also weak lysophosphatidylethanolamine acyltransferase activity (LPEAT activity). Favors polyunsaturated fatty acyl-CoAs as acyl donors compared to saturated fatty acyl-CoAs. Seems to be the major enzyme contributing to LPCAT activity in the liver. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle. Belongs to the membrane-bound acyltransferase family.

Protein type: Membrane protein, multi-pass; Transferase; Membrane protein, integral; EC 2.3.1.n6; EC 2.3.1.23

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: endoplasmic reticulum membrane; integral to membrane; membrane

Molecular Function: 1-acylglycerophosphocholine O-acyltransferase activity

Biological Process: glycerophospholipid biosynthetic process; phospholipid metabolic process

Research Articles on LPCAT3

Similar Products

Product Notes

The LPCAT3 lpcat3 (Catalog #AAA3222614) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LPCAT3 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LPCAT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LPCAT3 lpcat3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TVVALAGVLQ SGFQELSLNK LATSLGASEQ ALRLIISIFL GYPFALFYRH. It is sometimes possible for the material contained within the vial of "LPCAT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.