Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ABI2Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ABI2 Polyclonal Antibody | anti-ABI2 antibody

ABI2 Antibody - middle region

Gene Names
ABI2; AIP1; ABI-2; ABI2B; AIP-1; AblBP3; argBP1; SSH3BP2; argBPIA; argBPIB
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ABI2; Polyclonal Antibody; ABI2 Antibody - middle region; anti-ABI2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPPPPPVEEPVFDESPPPPPPPEDYEEEEAAVVEYSDPYAEEDPPWAPRS
Sequence Length
475
Applicable Applications for anti-ABI2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human ABI2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ABI2Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ABI2Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ABI2 antibody
May act in regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Regulates ABL1/c-Abl-mediated phosphorylation of MENA. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes (By similarity).
Product Categories/Family for anti-ABI2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
abl interactor 2 isoform a
NCBI Official Synonym Full Names
abl interactor 2
NCBI Official Symbol
ABI2
NCBI Official Synonym Symbols
AIP1; ABI-2; ABI2B; AIP-1; AblBP3; argBP1; SSH3BP2; argBPIA; argBPIB
NCBI Protein Information
abl interactor 2
UniProt Protein Name
Abl interactor 2
Protein Family
UniProt Gene Name
ABI2
UniProt Synonym Gene Names
ARGBPIA; Abi-2; AblBP3; ArgBP1
UniProt Entry Name
ABI2_HUMAN

Uniprot Description

Abi-2: May act in regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Regulates ABL1/c-Abl-mediated phosphorylation of MENA. Belongs to the ABI family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2q33

Cellular Component: cytoskeleton; lamellipodium; cytoplasm; cytosol; filopodium

Molecular Function: protein binding; DNA binding; ubiquitin protein ligase binding; Rac GTPase binding; protein complex binding; cytoskeletal adaptor activity; kinase binding; SH3 domain binding

Biological Process: cell migration; peptidyl-tyrosine phosphorylation; actin polymerization and/or depolymerization; Rac protein signal transduction; cytoskeleton organization and biogenesis; cell motility

Research Articles on ABI2

Similar Products

Product Notes

The ABI2 abi2 (Catalog #AAA3222403) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABI2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ABI2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ABI2 abi2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPPPPPVEEP VFDESPPPPP PPEDYEEEEA AVVEYSDPYA EEDPPWAPRS. It is sometimes possible for the material contained within the vial of "ABI2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.